PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MA_802073g0010 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 227aa MW: 26336.1 Da PI: 8.8303 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 135.8 | 2.9e-42 | 20 | 147 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 pGfrF Pt+ elv +yL+++v+g++ l+++ +i+++d+y+++Pw+L +++a+e++w+fF++rd++++ r+nr t sgyWkatg+d++v + MA_802073g0010 20 IPGFRFYPTEAELVGFYLRRRVQGDHpLNFNIIIPTLDLYRYDPWELAgFAHDARERQWFFFVPRDHNKS-CPRPNRLTVSGYWKATGSDRPVRN 113 69**********************996666667**************9667788999*********9876.68********************** PP NAM 95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++ + +glkk+Lvfykg+ + +ktdWvm+eyr+ MA_802073g0010 114 ERLQCIGLKKILVFYKGKGRYVQKTDWVMNEYRM 147 999*****************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.22E-43 | 12 | 168 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 47.216 | 19 | 168 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.7E-24 | 21 | 147 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 227 aa Download sequence Send to blast |
MAMLEEVYND GVVQGELTVI PGFRFYPTEA ELVGFYLRRR VQGDHPLNFN IIIPTLDLYR 60 YDPWELAGFA HDARERQWFF FVPRDHNKSC PRPNRLTVSG YWKATGSDRP VRNERLQCIG 120 LKKILVFYKG KGRYVQKTDW VMNEYRMPDF SSSAHKMNDI VLCQIHRKAV SQKSMDKGAK 180 PNPVEKKEPV VSCDEYEEKS HSITLNRSLI QSNPTPETVE VSSLFTA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-37 | 16 | 173 | 14 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-37 | 16 | 173 | 14 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-37 | 16 | 173 | 14 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-37 | 16 | 173 | 14 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-37 | 16 | 173 | 17 | 173 | NAC domain-containing protein 19 |
3swm_B | 1e-37 | 16 | 173 | 17 | 173 | NAC domain-containing protein 19 |
3swm_C | 1e-37 | 16 | 173 | 17 | 173 | NAC domain-containing protein 19 |
3swm_D | 1e-37 | 16 | 173 | 17 | 173 | NAC domain-containing protein 19 |
3swp_A | 1e-37 | 16 | 173 | 17 | 173 | NAC domain-containing protein 19 |
3swp_B | 1e-37 | 16 | 173 | 17 | 173 | NAC domain-containing protein 19 |
3swp_C | 1e-37 | 16 | 173 | 17 | 173 | NAC domain-containing protein 19 |
3swp_D | 1e-37 | 16 | 173 | 17 | 173 | NAC domain-containing protein 19 |
4dul_A | 1e-37 | 16 | 173 | 14 | 170 | NAC domain-containing protein 19 |
4dul_B | 1e-37 | 16 | 173 | 14 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010935230.2 | 6e-52 | NAC domain-containing protein 22 | ||||
Swissprot | Q9ZVP8 | 2e-48 | NAC35_ARATH; NAC domain-containing protein 35 | ||||
TrEMBL | A0A075M5N5 | 4e-96 | A0A075M5N5_9SPER; NAC domain protein | ||||
STRING | XP_008791987.1 | 2e-51 | (Phoenix dactylifera) | ||||
STRING | XP_008813634.1 | 3e-51 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP17 | 15 | 800 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G02450.1 | 3e-51 | NAC domain containing protein 35 |
Publications ? help Back to Top | |||
---|---|---|---|
|