PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MA_608139g0010 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 194aa MW: 21146.5 Da PI: 7.3235 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 107.2 | 1.3e-33 | 10 | 66 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 dep+YVNaKQy++Il+RRq+Rak+e e+kl +k rkpylheSRh hA+rR+Rg+gGrF MA_608139g0010 10 DEPVYVNAKQYHGILRRRQSRAKAELENKL-IKVRKPYLHESRHLHAMRRARGCGGRF 66 79****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 2.2E-37 | 8 | 69 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 38.68 | 9 | 69 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 2.8E-28 | 11 | 66 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 2.4E-24 | 12 | 34 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 14 | 34 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 2.4E-24 | 43 | 66 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 194 aa Download sequence Send to blast |
MPLPSDVIED EPVYVNAKQY HGILRRRQSR AKAELENKLI KVRKPYLHES RHLHAMRRAR 60 GCGGRFLNTK LLETTKVNAD SGKLTEGQHA WAVSSSSTEA LQSENGNMNS SEVHGNSGLS 120 GSEVTSMSES CPDGTSYSYT QGNGGYLYHH ASSHFHLLGF SPLSDGSGEV ESGQGMGYGI 180 KWIAAESCCD PMKV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 2e-21 | 10 | 85 | 2 | 76 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT104913 | 0.0 | BT104913.1 Picea glauca clone GQ02816_I15 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010247679.1 | 3e-52 | PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X1 | ||||
Refseq | XP_010247683.1 | 2e-52 | PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X2 | ||||
Refseq | XP_010247690.1 | 8e-53 | PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X3 | ||||
Swissprot | Q84JP1 | 2e-35 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
Swissprot | Q9LNP6 | 6e-35 | NFYA8_ARATH; Nuclear transcription factor Y subunit A-8 | ||||
TrEMBL | A0A0D6QWS4 | 6e-88 | A0A0D6QWS4_ARACU; Uncharacterized protein | ||||
STRING | XP_010247679.1 | 1e-51 | (Nelumbo nucifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP680 | 16 | 72 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.1 | 7e-38 | nuclear factor Y, subunit A7 |
Publications ? help Back to Top | |||
---|---|---|---|
|