PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MA_308669g0010 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 192aa MW: 21942.8 Da PI: 8.5768 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 41 | 4.6e-13 | 14 | 59 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 +g+WT+eEd +l+ ++ +G g+W++ +r g+ R++k+c+ r + MA_308669g0010 14 KGAWTPEEDARLIAHIRAHGEGCWRSLPRAAGLLRCGKSCRIRRIN 59 79******************************99*******87665 PP | |||||||
2 | Myb_DNA-binding | 57.7 | 2.7e-18 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++++eEde ++++ lG++ W++Iar+++ gRt++++k++w++y MA_308669g0010 67 RGNFSEEEDEFIIKLYSTLGNK-WSLIARRLP-GRTDNEIKNYWNTY 111 89********************.*********.************99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 8.6E-19 | 5 | 65 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 11.737 | 9 | 58 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.23E-25 | 13 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.0E-8 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.7E-10 | 14 | 59 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 27.652 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.7E-26 | 66 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.9E-17 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.5E-16 | 67 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.23E-13 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 192 aa Download sequence Send to blast |
MGRSPCCEKA HTNKGAWTPE EDARLIAHIR AHGEGCWRSL PRAAGLLRCG KSCRIRRINY 60 PRPDVKRGNF SEEEDEFIIK LYSTLGNKWS LIARRLPGRT DNEIKNYWNT YIKKKLLKRG 120 LDHQFDSPLC SPHNSNTTRS SRPAPEHQIP AFQSPRTPEI ADFFQYDLSG CSPIEPAASK 180 DEEHPDINLD LC |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 1e-25 | 13 | 116 | 26 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. | |||||
UniProt | Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269|PubMed:11080161}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269|PubMed:11080161}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FJ469923 | 0.0 | FJ469923.1 Picea glauca R2R3-MYB transcription factor MYB17 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010028718.1 | 6e-81 | PREDICTED: myb-related protein 308 | ||||
Swissprot | P81393 | 1e-73 | MYB08_ANTMA; Myb-related protein 308 | ||||
Swissprot | Q9SZP1 | 2e-73 | MYB4_ARATH; Transcription repressor MYB4 | ||||
TrEMBL | C0JTD6 | 1e-128 | C0JTD6_PICGL; R2R3-MYB transcription factor MYB17 | ||||
STRING | XP_010028718.1 | 2e-80 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G38620.1 | 7e-76 | myb domain protein 4 |