PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MA_267974g0010 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 164aa MW: 17217.7 Da PI: 10.9783 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 26.1 | 2.1e-08 | 3 | 40 | 10 | 47 |
HHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 10 ellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 l++ + ++G+g+Wk+I+r + Rt+ q+ s+ qky MA_267974g0010 3 RLFLLGLDKHGKGDWKSISRNFVISRTPTQVASHAQKY 40 67888999***************99************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 12.173 | 1 | 45 | IPR017930 | Myb domain |
Pfam | PF00249 | 9.2E-7 | 2 | 40 | IPR001005 | SANT/Myb domain |
TIGRFAMs | TIGR01557 | 3.6E-11 | 2 | 43 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 6.8E-6 | 2 | 39 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.38E-6 | 2 | 41 | No hit | No description |
SuperFamily | SSF46689 | 1.37E-10 | 2 | 46 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 164 aa Download sequence Send to blast |
MERLFLLGLD KHGKGDWKSI SRNFVISRTP TQVASHAQKY FIRMNSANKD RRRSSIHDIT 60 SVNNGDTSIP QGSITGQGNG STGAVGKPAK SLSEPGLPRV VAYGPPVGHP IAVPAGSAVG 120 TPIMIPPGHV PYVSRGSLPG PVVPGTPMNV VPVAYPVSQP TMHQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT123964 | 0.0 | BT123964.1 Picea sitchensis clone WS04719_C07 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011624612.1 | 4e-63 | transcription factor SRM1 | ||||
Swissprot | Q9FNN6 | 4e-47 | SRM1_ARATH; Transcription factor SRM1 | ||||
TrEMBL | A0A0D6R5A2 | 7e-80 | A0A0D6R5A2_ARACU; Uncharacterized protein | ||||
STRING | EOX99047 | 5e-60 | (Theobroma cacao) | ||||
STRING | XP_004513249.1 | 5e-60 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP275 | 17 | 122 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G08520.1 | 2e-49 | MYB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|