PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_20925g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Nin-like
Protein Properties Length: 941aa    MW: 103617 Da    PI: 6.6906
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_20925g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK924.5e-29476526252
         RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                    ek+isle+l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  MA_20925g0010 476 EKTISLEVLQQYFAGSLKDAAKDIGVCPTTLKRICRQHGISRWPSRKINKV 526
                    799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.268465546IPR003035RWP-RK domain
PfamPF020422.0E-25478526IPR003035RWP-RK domain
SuperFamilySSF542773.21E-23843930No hitNo description
PROSITE profilePS5174519.989845919IPR000270PB1 domain
SMARTSM006663.0E-22845927IPR000270PB1 domain
PfamPF005645.2E-16848924IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2405.4E-23848927No hitNo description
CDDcd064078.89E-30849926No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 941 aa     Download sequence    Send to blast
MEDWEAWMEE TALFSPSLLQ SAVAPPPSPA PSNFSDGDGD LSLRKRMMQA LRYIKDSDST  60
GQNVLAQVWV PVRQGAKHML TTCGQPFVVA SPNGGLFQYR TVSLTYLFSA REEGEDEEEE  120
GGDGHGHSHA LLGLPGRVFR RKLPEWTPNY YSVSEYPRVS HAQHYNVRGT VALPVFEPWG  180
QSCVGVVELV MTAQKINYAP EVEKVCRALQ AVNLRSSEIL DHPQVQFLRH INCHWLRLGF  240
HAGIETSSLP GVKGQGLPGK AFASNQPCFS NDISSFSKTE YPLVHYARLF NLAAAVAIRL  300
RSTHTGNDDY ILEFFLPTDC KDSQNLQMLL KSVSVTMHHN EFPEDVQWTN CNNISRISPE  360
LQISPGAEFV QCQERKQIVR QDSFQQALQA GSEGDQNEIQ MGQHPITSLP FVSCQKQQPE  420
LEGSNLSDLK QHRHESAQIN KEISAVLAND DILCSGSLQE HTNIRKGLEK KRGKMEKTIS  480
LEVLQQYFAG SLKDAAKDIG VCPTTLKRIC RQHGISRWPS RKINKVNRSL KKLQGVIESV  540
KGVGAFKIGN LSTGLVSAAT VPNTSSVHGK SSPAVVQGAA NHDLDMVPPP SNEEVIGIKT  600
SLPGKDCIMP EDFSSSQCQV IATLGTSLSS RLQSIKPGST HIFQETYSVG HAVHVKDVML  660
DENTNGNLHR VENGHVSYVH GATNGISESR NSESPQESIR TPSSQASHPD LSQIHLNSIE  720
DHADPPTITA FSRPPASQCH GGGENLMSQL EFINNGETSL HKRQATSSIL KNTHSETAVN  780
CKRKKLPVES SSDQKPTDFS GQGECLAEAI QSNSRNLSPQ HRCDSRILNL AGLQRDRIIQ  840
EGNKSTIFKV TYKQDTVRFR LPLNAGVSEL HDEVTKRFKL EAGTFDLKYL DDDHEWVLLA  900
CDADLQECIG ILNLSGGKAI KLVVYDMSSN VGSSCESSGE L
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1222590.0BT122259.1 Picea sitchensis clone WS0442_G03 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022736359.11e-138protein NLP6-like isoform X3
TrEMBLD5A7X90.0D5A7X9_PICSI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.28e-98Nin-like family protein