PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MA_173815g0010 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 95aa MW: 10275.5 Da PI: 8.2921 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 96.8 | 1.7e-30 | 27 | 81 | 2 | 57 |
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 e+vrY+eC+kNhAas+Gg+avDGC Ef++s g+egtaaa+kCa C+CHR+FHRrev MA_173815g0010 27 EGVRYRECRKNHAASIGGYAVDGCAEFIAS-GDEGTAAAMKCASCNCHRSFHRREV 81 579**************************9.999********************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 5.0E-20 | 24 | 91 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 2.4E-29 | 29 | 81 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 7.2E-26 | 30 | 81 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 25.397 | 31 | 80 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 95 aa Download sequence Send to blast |
MGPSKRVQQI EEGTAAIARE GDIVSREGVR YRECRKNHAA SIGGYAVDGC AEFIASGDEG 60 TAAAMKCASC NCHRSFHRRE VGNGTQCECR RIRGL |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. | |||||
UniProt | Putative transcription factor. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT104864 | 1e-103 | BT104864.1 Picea glauca clone GQ02815_P23 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010931461.2 | 1e-29 | mini zinc finger protein 2 | ||||
Refseq | XP_020101124.1 | 2e-29 | mini zinc finger protein 1-like | ||||
Swissprot | Q9LJW5 | 9e-24 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
Swissprot | Q9SVL0 | 1e-23 | ZHD7_ARATH; Zinc-finger homeodomain protein 7 | ||||
TrEMBL | A9NK89 | 3e-50 | A9NK89_PICSI; Uncharacterized protein | ||||
STRING | XP_008792497.1 | 2e-31 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP91 | 16 | 237 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28917.1 | 4e-26 | mini zinc finger 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|