PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MA_171206g0010

Organism

Picea abies

Taxonomic ID

3329

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea

Family

ZF-HD

Protein Properties

Length: 95aa MW: 10275.5 Da PI: 8.2921

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MA_171206g0010	genome	ConGenIE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	96.8	1.7e-30	27	81	2	57
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 e+vrY+eC+kNhAas+Gg+avDGC Ef++s g+egtaaa+kCa C+CHR+FHRrev MA_171206g0010 27 EGVRYRECRKNHAASIGGYAVDGCAEFIAS-GDEGTAAAMKCASCNCHRSFHRREV 81 579************************9.999******************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	5.0E-20	24	91	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	2.4E-29	29	81	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	7.2E-26	30	81	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	25.397	31	80	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 95 aa Download sequence Send to blast
MGPSKRVQQI EEGTAAIARE GDIVSREGVR YRECRKNHAA SIGGYAVDGC AEFIASGDEG 60 TAAAMKCASC NCHRSFHRRE VGNGTQCECR RIRGL

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.
UniProt	Putative transcription factor.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT104864	1e-103	BT104864.1 Picea glauca clone GQ02815_P23 mRNA sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010931461.2	1e-29	mini zinc finger protein 2
Refseq	XP_020101124.1	2e-29	mini zinc finger protein 1-like
Swissprot	Q9LJW5	9e-24	MIF2_ARATH; Mini zinc finger protein 2
Swissprot	Q9SVL0	1e-23	ZHD7_ARATH; Zinc-finger homeodomain protein 7
TrEMBL	A9NK89	3e-50	A9NK89_PICSI; Uncharacterized protein
STRING	XP_008792497.1	2e-31	(Phoenix dactylifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP91	16	237

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	4e-26	mini zinc finger 2

Publications ? help Back to Top
Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]