PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MA_11699g0010 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 99aa MW: 11148.5 Da PI: 3.8541 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 37.7 | 6e-12 | 1 | 40 | 61 | 100 |
DUF260 61 lvyeAearardPvyGavgvilklqqqleqlkaelallkee 100 +vyeA r+rdPv+G+vg+i++lq+++++l+++la++++e MA_11699g0010 1 MVYEASERIRDPVHGCVGIINELQNKVAELQSQLASAQAE 40 69*********************************99987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03195 | 1.1E-9 | 1 | 38 | IPR004883 | Lateral organ boundaries, LOB |
PROSITE profile | PS50891 | 9.551 | 1 | 41 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 99 aa Download sequence Send to blast |
MVYEASERIR DPVHGCVGII NELQNKVAEL QSQLASAQAE ITNITLQHVN LLPLVTGYHE 60 LSDPNFFCLS PQESEEMTQT SPSVLDDLDP LELWEPLWT |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT109375 | 1e-145 | BT109375.1 Picea glauca clone GQ03207_L09 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018845317.1 | 3e-22 | PREDICTED: LOB domain-containing protein 1-like | ||||
TrEMBL | B8LQI9 | 1e-31 | B8LQI9_PICSI; Uncharacterized protein |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP16263 | 2 | 3 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G07900.1 | 9e-11 | LOB domain-containing protein 1 |