PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MA_112632g0010 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 194aa MW: 21265 Da PI: 7.8201 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 103.9 | 1.4e-32 | 96 | 152 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep+YVNaKQy +Il+RRq+Rak+e+e+kl +k+rkpylheSRh hAl+R+Rg+gGrF MA_112632g0010 96 EEPVYVNAKQYYGILRRRQSRAKAESENKL-IKNRKPYLHESRHLHALKRARGCGGRF 152 69****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 1.5E-37 | 94 | 155 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 37.292 | 95 | 155 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 2.0E-27 | 97 | 152 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 4.3E-23 | 98 | 120 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 100 | 120 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 4.3E-23 | 129 | 152 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 194 aa Download sequence Send to blast |
IDGSAPDEQQ PQADPVQQEA PPPGMIPPPA MTLLPPEFVM PHTQLELGQA MVRAAYPYPD 60 PYFGGIVAAY GPQAVIHPHM LGVPHAGLPL PSDAVEEPVY VNAKQYYGIL RRRQSRAKAE 120 SENKLIKNRK PYLHESRHLH ALKRARGCGG RFLNAKKQDE VSQENNSNGN IVHVPSVDKP 180 DAEKKSSSAQ NTDS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 7e-22 | 95 | 159 | 1 | 65 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT104418 | 0.0 | BT104418.1 Picea glauca clone GQ02810_C14 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020268973.1 | 5e-71 | nuclear transcription factor Y subunit A-7 isoform X1 | ||||
Refseq | XP_020268974.1 | 5e-71 | nuclear transcription factor Y subunit A-7 isoform X1 | ||||
Refseq | XP_020268975.1 | 5e-71 | nuclear transcription factor Y subunit A-7 isoform X1 | ||||
Refseq | XP_020268976.1 | 5e-71 | nuclear transcription factor Y subunit A-7 isoform X1 | ||||
Swissprot | Q84JP1 | 5e-49 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | A0A2K1KAU8 | 3e-66 | A0A2K1KAU8_PHYPA; Uncharacterized protein | ||||
STRING | PP1S42_174V6.1 | 5e-67 | (Physcomitrella patens) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP680 | 16 | 72 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.2 | 1e-51 | nuclear factor Y, subunit A7 |
Publications ? help Back to Top | |||
---|---|---|---|
|