PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MA_108542g0010 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 119aa MW: 13754.4 Da PI: 6.1213 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 46.2 | 1.1e-14 | 22 | 67 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 +g+WT eEd +l +++++G g+W+ ar g++Rt+ +c++rw++ MA_108542g0010 22 KGPWTVEEDMQLTGYIRLHGEGRWSFLARAAGLNRTGRSCRLRWLN 67 79******************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 19.607 | 17 | 73 | IPR017930 | Myb domain |
SMART | SM00717 | 2.4E-12 | 21 | 71 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.0E-18 | 21 | 68 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.0E-12 | 22 | 67 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 6.42E-20 | 23 | 90 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.03E-8 | 24 | 69 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.4E-5 | 69 | 90 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 119 aa Download sequence Send to blast |
MENISRWGAS DIEDEEEAET RKGPWTVEED MQLTGYIRLH GEGRWSFLAR AAGLNRTGRS 60 CRLRWLNSLR PDLKRSKITP EEERLIIELH GHGLALHGVY QEGRITTLRI TGELESREN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-13 | 22 | 90 | 7 | 74 | B-MYB |
1h8a_C | 4e-13 | 18 | 90 | 23 | 94 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024950397.1 | 1e-37 | myb-related protein 305 isoform X2 | ||||
Swissprot | P81391 | 5e-31 | MYB05_ANTMA; Myb-related protein 305 | ||||
TrEMBL | V4UC01 | 4e-36 | V4UC01_9ROSI; Uncharacterized protein | ||||
STRING | cassava4.1_027838m | 5e-32 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G27810.1 | 6e-33 | myb domain protein 21 |
Publications ? help Back to Top | |||
---|---|---|---|
|