PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MA_10435549g0020 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 129aa MW: 14882.1 Da PI: 6.5185 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 105.4 | 8.1e-33 | 1 | 99 | 258 | 356 |
GRAS 258 lealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyr 350 +eal+yys++f+sl+a+l+res++r++vE+++l+r+ivn++aceg+er+er e +ekWr+r+++ GF+++pls ++ +++k+ll++ + + y+ MA_10435549g0020 1 MEALNYYSSVFESLDATLSRESRDRVNVEKQCLARDIVNIIACEGEERIERYEVAEKWRARMTMTGFSAYPLSANVKDTVKSLLHQSYCNSYK 93 69**************************************************************************************999** PP GRAS 351 veeesg 356 +ee g MA_10435549g0020 94 TKEEGG 99 **9977 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 20.49 | 1 | 97 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 2.8E-30 | 1 | 99 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 129 aa Download sequence Send to blast |
MEALNYYSSV FESLDATLSR ESRDRVNVEK QCLARDIVNI IACEGEERIE RYEVAEKWRA 60 RMTMTGFSAY PLSANVKDTV KSLLHQSYCN SYKTKEEGGX XXXXXXXXXX DGWIEFSLRH 120 LLGIKKQGL |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT106412 | 1e-144 | BT106412.1 Picea glauca clone GQ03001_C01 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003526667.1 | 2e-43 | scarecrow-like protein 1 | ||||
Refseq | XP_003526668.1 | 2e-43 | scarecrow-like protein 1 | ||||
Refseq | XP_010649367.1 | 1e-43 | PREDICTED: scarecrow-like protein 1 | ||||
Refseq | XP_014631848.1 | 2e-43 | scarecrow-like protein 1 | ||||
Refseq | XP_014631849.1 | 2e-43 | scarecrow-like protein 1 | ||||
Refseq | XP_014631850.1 | 2e-43 | scarecrow-like protein 1 | ||||
Refseq | XP_019075083.1 | 1e-43 | PREDICTED: scarecrow-like protein 1 | ||||
Refseq | XP_019075084.1 | 1e-43 | PREDICTED: scarecrow-like protein 1 | ||||
Refseq | XP_019075085.1 | 1e-43 | PREDICTED: scarecrow-like protein 1 | ||||
Refseq | XP_028235982.1 | 2e-43 | scarecrow-like protein 1 | ||||
Refseq | XP_028235983.1 | 2e-43 | scarecrow-like protein 1 | ||||
Refseq | XP_028235984.1 | 2e-43 | scarecrow-like protein 1 | ||||
Refseq | XP_028235985.1 | 2e-43 | scarecrow-like protein 1 | ||||
Refseq | XP_028235986.1 | 2e-43 | scarecrow-like protein 1 | ||||
Swissprot | Q9SDQ3 | 4e-42 | SCL1_ARATH; Scarecrow-like protein 1 | ||||
TrEMBL | A0A0B4U7X1 | 1e-60 | A0A0B4U7X1_PINRA; SCL7 (Fragment) | ||||
STRING | Aquca_014_00370.1 | 2e-43 | (Aquilegia coerulea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP10802 | 2 | 9 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G21450.1 | 2e-44 | SCARECROW-like 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|