PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MA_10432903g0010 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 196aa MW: 22436.3 Da PI: 7.2058 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 53.6 | 5e-17 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEde+l+ ++ +G g+W++ ++ g+ R++k+c++rw +yl MA_10432903g0010 15 KGAWTKEEDERLIAHIEAHGEGSWRSLPKAAGLLRCGKSCRLRWINYL 62 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 54.5 | 2.6e-17 | 68 | 113 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ ++eEd+l+++++ +lG++ W++Ia +++ gRt++++k++w++++ MA_10432903g0010 68 RGSISEEEDDLIIKLHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNTHM 113 7888******************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 14.69 | 10 | 62 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.04E-29 | 14 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.8E-13 | 14 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.7E-15 | 15 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.5E-22 | 16 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.58E-10 | 17 | 62 | No hit | No description |
PROSITE profile | PS51294 | 27.923 | 63 | 117 | IPR017930 | Myb domain |
SMART | SM00717 | 6.3E-17 | 67 | 115 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-15 | 68 | 112 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.4E-27 | 70 | 117 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.57E-12 | 72 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 196 aa Download sequence Send to blast |
MGRSPCCENV HTNNKGAWTK EEDERLIAHI EAHGEGSWRS LPKAAGLLRC GKSCRLRWIN 60 YLRPDLKRGS ISEEEDDLII KLHSLLGNRW SLIAGRLPGR TDNEIKNYWN THMKRKLLSR 120 GIDPQSHRPL GQPCKTTLSS RPVLEHEIQA FQSPGTAEVA DFFQYDRPES SAIERADSDA 180 EERPDLNLDL CIWHMQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 1e-31 | 14 | 117 | 26 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269|PubMed:11080161}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269|PubMed:11080161}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT118999 | 0.0 | BT118999.1 Picea glauca clone GQ04013_D12 mRNA sequence. | |||
GenBank | EF601076 | 0.0 | EF601076.1 Picea glauca R2R3-MYB transcription factor MYB13 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004957488.1 | 3e-85 | myb-related protein Hv1 | ||||
Swissprot | Q9SZP1 | 1e-82 | MYB4_ARATH; Transcription repressor MYB4 | ||||
TrEMBL | A5JYF7 | 1e-138 | A5JYF7_PICGL; R2R3-MYB transcription factor MYB13 | ||||
STRING | Si030943m | 1e-84 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G38620.1 | 4e-85 | myb domain protein 4 |