PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Oropetium_20150105_26169A | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 197aa MW: 22027.9 Da PI: 8.9558 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 53.1 | 7.6e-17 | 14 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd +l++ ++++G+g +W + +++ g++R++k+c++rw++yl Oropetium_20150105_26169A 14 KGPWSPEEDAKLKEFIEKHGTGgNWIALPQKAGLRRCGKSCRLRWLNYL 62 79*********************************************97 PP | |||||||
2 | Myb_DNA-binding | 36.1 | 1.5e-11 | 69 | 111 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 g +T+ Ed + + G++ W+ Ia+ ++ gRt++++k++w++ Oropetium_20150105_26169A 69 GEFTEHEDRVICSMYASIGSR-WSIIASQLP-GRTDNDIKNYWNT 111 78*******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 21.884 | 9 | 66 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.08E-28 | 11 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.4E-13 | 13 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.2E-16 | 14 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.9E-24 | 15 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.06E-10 | 16 | 62 | No hit | No description |
PROSITE profile | PS51294 | 15.818 | 67 | 117 | IPR017930 | Myb domain |
SMART | SM00717 | 5.8E-11 | 67 | 115 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-9 | 69 | 111 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.3E-23 | 70 | 117 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 197 aa Download sequence Send to blast |
MGRAPCCDKN NVKKGPWSPE EDAKLKEFIE KHGTGGNWIA LPQKAGLRRC GKSCRLRWLN 60 YLRPNIKHGE FTEHEDRVIC SMYASIGSRW SIIASQLPGR TDNDIKNYWN TKLKKKLYSN 120 NGGSMDQHDT RSLLQLQEHF QAQVPVEYNY DEIKQLLMSS SAAAGNNLHG DQQVHHDGGG 180 MVEGLVGASQ GKVTMM* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-27 | 14 | 117 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factors that activates genes required for endodermal differentiation but represses genes involved in proliferative divisions, thus regulating the transition from proliferation to differentiation in root endodermis (PubMed:26371322). Required for Casparian strip formation by positively regulating the expression of the Casparian strip genes CASP1, PER64 and ESB1 and other endodermis-specific genes, thus triggering correct localized lignin biosynthesis in root endodermis and subsequently regulating global ion homeostasis (PubMed:26124109, PubMed:26371322). {ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Oropetium_20150105_26169A |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Directly up-regulated by SCARECROW (SCR), as part of the differentiation program controlled by SHORT-ROOT (SHR). {ECO:0000269|PubMed:24517883, ECO:0000269|PubMed:26371322}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HQ317215 | 7e-40 | HQ317215.1 Miscanthus sinensis clone MSSR25 microsatellite sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004975125.1 | 1e-84 | transcription factor RAX2 | ||||
Swissprot | Q9FKL2 | 7e-74 | MYB36_ARATH; Transcription factor MYB36 | ||||
TrEMBL | K3Y8T5 | 2e-83 | K3Y8T5_SETIT; Uncharacterized protein | ||||
STRING | Pavir.J31349.1.p | 6e-84 | (Panicum virgatum) | ||||
STRING | Si010627m | 4e-84 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP135 | 38 | 412 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G57620.1 | 3e-76 | myb domain protein 36 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Oropetium_20150105_26169A |
Publications ? help Back to Top | |||
---|---|---|---|
|