PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_24817A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family GATA
Protein Properties Length: 144aa    MW: 16120.4 Da    PI: 10.1279
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_24817AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA53.43.5e-172759133
                       GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkk 33
                               C+ C+ttkTplWR gp g+ +LCnaCG++yrk 
  Oropetium_20150105_24817A 27 CTECHTTKTPLWRGGPCGPMSLCNACGIRYRKX 59
                               *******************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577162.9E-121962No hitNo description
PROSITE profilePS5011413.58721101IPR000679Zinc finger, GATA-type
SMARTSM004011.1E-122172IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.7E-132259IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.30E-132658No hitNo description
PROSITE patternPS0034402752IPR000679Zinc finger, GATA-type
PfamPF003206.5E-152759IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MDSSVEKQGS GSLDPDERPA AGEPKACTEC HTTKTPLWRG GPCGPMSLCN ACGIRYRKXX  60
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXVTVEL RTVGFGKEVV LKQRRRMRRR  120
RRLGEEERAA ILLMALSSGV VYA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1112118QRRRMRR
2114119RRMRRR
3114121RRMRRRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00335DAPTransfer from AT3G06740Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_24817A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025794899.15e-49GATA transcription factor 16-like isoform X1
TrEMBLA0A3L6TEE14e-48A0A3L6TEE1_PANMI; GATA transcription factor 16-like isoform X1
STRINGPavir.J03766.1.p2e-51(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24183892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26930.17e-16GATA transcription factor 23