![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
Previous version:
v3.0
v4.0
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Oropetium_20150105_24817A | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 144aa MW: 16120.4 Da PI: 10.1279 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 53.4 | 3.5e-17 | 27 | 59 | 1 | 33 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkk 33 C+ C+ttkTplWR gp g+ +LCnaCG++yrk Oropetium_20150105_24817A 27 CTECHTTKTPLWRGGPCGPMSLCNACGIRYRKX 59 *******************************95 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF57716 | 2.9E-12 | 19 | 62 | No hit | No description |
PROSITE profile | PS50114 | 13.587 | 21 | 101 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 1.1E-12 | 21 | 72 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 2.7E-13 | 22 | 59 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 6.30E-13 | 26 | 58 | No hit | No description |
PROSITE pattern | PS00344 | 0 | 27 | 52 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 6.5E-15 | 27 | 59 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 144 aa Download sequence Send to blast |
MDSSVEKQGS GSLDPDERPA AGEPKACTEC HTTKTPLWRG GPCGPMSLCN ACGIRYRKXX 60 XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXVTVEL RTVGFGKEVV LKQRRRMRRR 120 RRLGEEERAA ILLMALSSGV VYA* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 112 | 118 | QRRRMRR |
2 | 114 | 119 | RRMRRR |
3 | 114 | 121 | RRMRRRRR |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00335 | DAP | Transfer from AT3G06740 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Oropetium_20150105_24817A |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025794899.1 | 5e-49 | GATA transcription factor 16-like isoform X1 | ||||
TrEMBL | A0A3L6TEE1 | 4e-48 | A0A3L6TEE1_PANMI; GATA transcription factor 16-like isoform X1 | ||||
STRING | Pavir.J03766.1.p | 2e-51 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2418 | 38 | 92 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26930.1 | 7e-16 | GATA transcription factor 23 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Oropetium_20150105_24817A |