PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Oropetium_20150105_22321A | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 127aa MW: 13815.7 Da PI: 9.0935 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 61.4 | 1.1e-19 | 21 | 55 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ C++t+Tp+WR+gp g+++LCnaCG++yrkk++ Oropetium_20150105_22321A 21 CVECRATTTPMWRSGPTGPRELCNACGIRYRKKRR 55 ********************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50114 | 12.848 | 15 | 51 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 5.5E-15 | 15 | 73 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 2.76E-13 | 17 | 56 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 5.3E-16 | 18 | 69 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 2.90E-13 | 20 | 56 | No hit | No description |
Pfam | PF00320 | 2.4E-17 | 21 | 55 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 21 | 46 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 127 aa Download sequence Send to blast |
MASADHKIAA IGVPEEGRRS CVECRATTTP MWRSGPTGPR ELCNACGIRY RKKRRQELGL 60 DQKQLQQQNH GEIKLEVKES NSCNSSTSSS NKLEVVQKGK HLMGVEEAAF LLMTLSSSPT 120 STLLNG* |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00554 | DAP | Transfer from AT5G49300 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Oropetium_20150105_22321A |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021310786.1 | 9e-54 | GATA transcription factor 23-like | ||||
TrEMBL | A0A1B6Q3G9 | 2e-52 | A0A1B6Q3G9_SORBI; Uncharacterized protein | ||||
STRING | Sb03g013700.1 | 3e-53 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6721 | 28 | 54 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26930.1 | 4e-18 | GATA transcription factor 23 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Oropetium_20150105_22321A |