PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_22321A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family GATA
Protein Properties Length: 127aa    MW: 13815.7 Da    PI: 9.0935
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_22321AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA61.41.1e-192155135
                       GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                               C+ C++t+Tp+WR+gp g+++LCnaCG++yrkk++
  Oropetium_20150105_22321A 21 CVECRATTTPMWRSGPTGPRELCNACGIRYRKKRR 55
                               ********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.8481551IPR000679Zinc finger, GATA-type
SMARTSM004015.5E-151573IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.76E-131756No hitNo description
Gene3DG3DSA:3.30.50.105.3E-161869IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.90E-132056No hitNo description
PfamPF003202.4E-172155IPR000679Zinc finger, GATA-type
PROSITE patternPS0034402146IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MASADHKIAA IGVPEEGRRS CVECRATTTP MWRSGPTGPR ELCNACGIRY RKKRRQELGL  60
DQKQLQQQNH GEIKLEVKES NSCNSSTSSS NKLEVVQKGK HLMGVEEAAF LLMTLSSSPT  120
STLLNG*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00554DAPTransfer from AT5G49300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_22321A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021310786.19e-54GATA transcription factor 23-like
TrEMBLA0A1B6Q3G92e-52A0A1B6Q3G9_SORBI; Uncharacterized protein
STRINGSb03g013700.13e-53(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67212854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26930.14e-18GATA transcription factor 23