PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Oropetium_20150105_21458A | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 154aa MW: 16981.6 Da PI: 7.8086 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 63.7 | 3.2e-20 | 83 | 129 | 13 | 59 |
E--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 13 KevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 K k+ + prsYYrCt++gC+vkk+v+r ++d+ vv++tYeg+H+h+ Oropetium_20150105_21458A 83 KGEKKERRPRSYYRCTHQGCNVKKQVQRLSKDEAVVVTTYEGTHTHP 129 44577889**************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03106 | 4.8E-16 | 80 | 129 | IPR003657 | WRKY domain |
SMART | SM00774 | 6.1E-13 | 80 | 130 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 18.142 | 82 | 131 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 9.9E-19 | 83 | 129 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 6.67E-17 | 84 | 130 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000122 | Biological Process | negative regulation of transcription from RNA polymerase II promoter | ||||
GO:0010055 | Biological Process | atrichoblast differentiation | ||||
GO:0032107 | Biological Process | regulation of response to nutrient levels | ||||
GO:0043620 | Biological Process | regulation of DNA-templated transcription in response to stress | ||||
GO:0048527 | Biological Process | lateral root development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0001046 | Molecular Function | core promoter sequence-specific DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 154 aa Download sequence Send to blast |
MESNYHPMLF ATQPSSSTSH SYHFMAPATA TETSSQLHDH HDRHGSSSSL MGELSNSKDG 60 GESSARVTSE ADRSPGGVLG KKKGEKKERR PRSYYRCTHQ GCNVKKQVQR LSKDEAVVVT 120 TYEGTHTHPI EKSNDNFEHI LTQMQIYSGI ESA* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-12 | 61 | 130 | 4 | 76 | Probable WRKY transcription factor 4 |
2lex_A | 2e-12 | 61 | 130 | 4 | 76 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00506 | DAP | Transfer from AT5G13080 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Oropetium_20150105_21458A |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025826645.1 | 4e-58 | probable WRKY transcription factor 75 isoform X2 | ||||
Swissprot | Q9FYA2 | 2e-31 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | A0A2S3IEZ6 | 8e-57 | A0A2S3IEZ6_9POAL; Uncharacterized protein | ||||
STRING | Si026859m | 3e-52 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1100 | 38 | 133 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 4e-32 | WRKY DNA-binding protein 75 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Oropetium_20150105_21458A |