PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Oropetium_20150105_21067A | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 116aa MW: 13432.5 Da PI: 8.8393 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 106.2 | 4.6e-33 | 1 | 99 | 267 | 366 |
GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyr 350 +f+s+++ lpr+++ r++ E+++++r+ivn++acegaer+erhe ++kW++r+++aGF+p+pl++ +++++++llr ++s yr Oropetium_20150105_21067A 1 MFESIDVALPRDDKRRMSTEQHCVARDIVNIIACEGAERVERHELFGKWKARFSMAGFRPYPLNSVVNNTINTLLRSYNSC-YR 83 7******************************************************************************55.** PP GRAS 351 veeesgslvlgWkdrp 366 +ee++g l+lgWk+r+ Oropetium_20150105_21067A 84 LEERDGVLYLGWKNRE 99 **************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03514 | 1.5E-30 | 1 | 99 | IPR005202 | Transcription factor GRAS |
PROSITE profile | PS50985 | 18.722 | 1 | 88 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 116 aa Download sequence Send to blast |
MFESIDVALP RDDKRRMSTE QHCVARDIVN IIACEGAERV ERHELFGKWK ARFSMAGFRP 60 YPLNSVVNNT INTLLRSYNS CYRLEERDGV LYLGWKNREF GLLKAGFALY RIDVI* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Oropetium_20150105_21067A |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT087542 | 7e-88 | BT087542.1 Zea mays full-length cDNA clone ZM_BFb0105H01 mRNA, complete cds. | |||
GenBank | HQ858766 | 7e-88 | HQ858766.1 Zea mays clone UT1682 GRAS transcription factor mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025793720.1 | 4e-61 | scarecrow-like protein 21 | ||||
Refseq | XP_025793721.1 | 4e-61 | scarecrow-like protein 21 | ||||
Refseq | XP_025793722.1 | 4e-61 | scarecrow-like protein 21 | ||||
Refseq | XP_025793723.1 | 4e-61 | scarecrow-like protein 21 | ||||
Swissprot | Q9LDL7 | 3e-48 | PAT1_ARATH; Scarecrow-like transcription factor PAT1 | ||||
TrEMBL | A0A0A9N408 | 3e-62 | A0A0A9N408_ARUDO; SCL21 | ||||
TrEMBL | A0A2T7C735 | 3e-60 | A0A2T7C735_9POAL; Uncharacterized protein | ||||
STRING | Pavir.Ia02739.1.p | 4e-61 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP51499 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G48150.2 | 1e-50 | GRAS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Oropetium_20150105_21067A |
Publications ? help Back to Top | |||
---|---|---|---|
|