PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Oropetium_20150105_19870A

Organism

Oropetium thomaeum

Taxonomic ID

1148796

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium

Family

NAC

Protein Properties

Length: 299aa MW: 32901.9 Da PI: 6.5078

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Oropetium_20150105_19870A	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	161.5	3.3e-50	10	138	1	129
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWk 84 lppGfrF P+deelv++yL+kkv+++++ ++ evd++ ePw+Lp +k +++ewyfFs rd+kyatg+r+nratk+gyWk Oropetium_20150105_19870A 10 LPPGFRFYPNDEELVSFYLRKKVANERVAS-GTLVEVDLHAREPWELPDVAKLTSQEWYFFSFRDRKYATGSRTNRATKTGYWK 92 79***********************888.88***********77777889************************ PP NAM 85 atgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrle 129 atgkd+ vl+ ++ vg++ktLvfy grap+g+kt Wvmhe+rle Oropetium_20150105_19870A 93 ATGKDRVVLEPgTRVMVGMRKTLVFYLGRAPNGQKTGWVMHEFRLE 138 ******955667*************************985 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	8.76E-60	8	156	IPR003441	NAC domain
PROSITE profile	PS51005	58.666	10	156	IPR003441	NAC domain
Pfam	PF02365	6.3E-28	11	137	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 299 aa Download sequence Send to blast
MGLRGLDSAL PPGFRFYPND EELVSFYLRK KVANERVASG TLVEVDLHAR EPWELPDVAK 60 LTSQEWYFFS FRDRKYATGS RTNRATKTGY WKATGKDRVV LEPGTRVMVG MRKTLVFYLG 120 RAPNGQKTGW VMHEFRLETP NSPPKEDWVL CRVFNKRKSS ETEQSSTDLH HNHGTALYCS 180 SLQHDAAIAG SRPYDQRHQE ATAAVSQCGS SGDPLMNLTM LQQGSFLDYC SSVVHDDVAA 240 AEPHSSGAGD AAMTMSTGPG RALGFEDHGN GVVGEIEMEY DVQALLLGSC CGSSGIYF*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	3e-52	1	161	4	170	NO APICAL MERISTEM PROTEIN
1ut4_B	3e-52	1	161	4	170	NO APICAL MERISTEM PROTEIN
1ut7_A	3e-52	1	161	4	170	NO APICAL MERISTEM PROTEIN
1ut7_B	3e-52	1	161	4	170	NO APICAL MERISTEM PROTEIN
3swm_A	3e-52	1	161	7	173	NAC domain-containing protein 19
3swm_B	3e-52	1	161	7	173	NAC domain-containing protein 19
3swm_C	3e-52	1	161	7	173	NAC domain-containing protein 19
3swm_D	3e-52	1	161	7	173	NAC domain-containing protein 19
3swp_A	3e-52	1	161	7	173	NAC domain-containing protein 19
3swp_B	3e-52	1	161	7	173	NAC domain-containing protein 19
3swp_C	3e-52	1	161	7	173	NAC domain-containing protein 19
3swp_D	3e-52	1	161	7	173	NAC domain-containing protein 19
4dul_A	3e-52	1	161	4	170	NAC domain-containing protein 19
4dul_B	3e-52	1	161	4	170	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269\|PubMed:12837947, ECO:0000269\|PubMed:17122068}.
UniProt	Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250\|UniProtKB:Q9LVA1, ECO:0000269\|PubMed:16103214, ECO:0000269\|PubMed:25148240}.
UniProt	Transcriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269\|PubMed:11114891}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Oropetium_20150105_19870A

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269\|PubMed:16854978}.
UniProt	INDUCTION: Induced by auxin.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004982866.1	1e-133	protein CUP-SHAPED COTYLEDON 3
Swissprot	Q84TE6	2e-59	NAC22_ARATH; NAC domain-containing protein 21/22
Swissprot	Q9FWX2	3e-59	NAC7_ARATH; NAC domain-containing protein 7
Swissprot	Q9S851	2e-59	NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBL	K4AD78	1e-131	K4AD78_SETIT; Uncharacterized protein
STRING	Si036835m	1e-132	(Setaria italica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP697	38	166

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G28530.1	1e-79	NAC domain containing protein 74

Link Out ? help Back to Top
Phytozome	Oropetium_20150105_19870A

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Heyndrickx KS,Vandepoele K Systematic identification of functional plant modules through the integration of complementary data sources. Plant Physiol., 2012. 159(3): p. 884-901 [PMID:22589469] Le Hénanff G, et al. Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance. J. Exp. Bot., 2013. 64(16): p. 4877-93 [PMID:24043850] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Chen C, et al. Transcriptome profiling reveals roles of meristem regulators and polarity genes during fruit trichome development in cucumber (Cucumis sativus L.). J. Exp. Bot., 2014. 65(17): p. 4943-58 [PMID:24962999] Gonçalves B, et al. A conserved role for CUP-SHAPED COTYLEDON genes during ovule development. Plant J., 2015. 83(4): p. 732-42 [PMID:26119568] Xiao D, et al. SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis. Plant Physiol., 2015. 169(2): p. 1275-91 [PMID:26304848] Huo X,Wang C,Teng Y,Liu X Identification of miRNAs associated with dark-induced senescence in Arabidopsis. BMC Plant Biol., 2015. 15: p. 266 [PMID:26530097] Chen X, et al. Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis. Plant Physiol., 2016. 170(4): p. 2136-45 [PMID:26850273] Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis. Plant J., 2017. 90(3): p. 435-446 [PMID:28161901] Espinosa-Ruiz A, et al. TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana. Development, 2017. 144(9): p. 1619-1628 [PMID:28320734] Koyama T,Sato F,Ohme-Takagi M Roles of miR319 and TCP Transcription Factors in Leaf Development. Plant Physiol., 2017. 175(2): p. 874-885 [PMID:28842549] Liu C,Wang B,Li Z,Peng Z,Zhang J TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth. Plant Physiol., 2018. 176(1): p. 742-756 [PMID:29122985]