PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_19136A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family CO-like
Protein Properties Length: 434aa    MW: 46827.2 Da    PI: 10.4157
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_19136AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.65.4e-081657338
                   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                               +r C+ + + +++++C  ++ +lC+ C  + H+       H+
  Oropetium_20150105_19136A 16 ARACDSCLRRRARWYCGADDAFLCQACDASVHSAnllarrHE 57
                               578*****************************6567777776 PP

2CCT67.24.4e-23336379144
                        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                Rea+++RY+eKr+tR+F KkirYe+RK +Ae+RpR+KGrFvk++
  Oropetium_20150105_19136A 336 REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRP 379
                                9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.6081461IPR000315B-box-type zinc finger
SMARTSM003369.9E-111461IPR000315B-box-type zinc finger
PfamPF006431.0E-61758IPR000315B-box-type zinc finger
CDDcd000219.01E-91961No hitNo description
PfamPF062034.9E-18336378IPR010402CCT domain
PROSITE profilePS5101715.993336378IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MSSSTAAAGA VGGKAARACD SCLRRRARWY CGADDAFLCQ ACDASVHSAN LLARRHERLR  60
LRPTASSPPH VTASTSKSKR SRQAGPGWSK RKARTRRPRH KSVGELLSRK LVVVAPDQVP  120
SDESSEERKA DNAEEHSLLY HCVPTFDRAL XXXXXXXXXX DRESVVGAVE NVIGPMPPPT  180
TEDGGERVKM KSDSAVSNNS AMKSRAAEMK SEAASAEVLD IDFNCCSPTA VEDDEEGEDS  240
FDRKATTTTT SNGDAAAAAQ FLRRSLDLRL NYEAVIESWG SSPWTDGQRP QQLRLDDFWP  300
HHAAYHSGLW PAGGGRPPGG GGPLPRLRCG TDAGAREARV SRYREKRRTR LFAKKIRYEV  360
RKLNAEKRPR MKGRFVKRPA AAGAAGGGAG SIAAAPCAVV TQQPKKKVGS QRAGACPPVS  420
QQVIMQSRIT GSA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1313321GGRPPGGGG
2346362RRTRLFAKKIRYEVRKL
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_19136A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1203141e-64AK120314.1 Oryza sativa Japonica Group cDNA clone:J013055L13, full insert sequence.
GenBankAP0048881e-64AP004888.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0617A09.
GenBankAP0053191e-64AP005319.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0643A10.
GenBankAP0149581e-64AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126101e-64CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025797872.11e-125zinc finger protein CONSTANS-LIKE 16-like
TrEMBLA0A2S3GT231e-123A0A2S3GT23_9POAL; Uncharacterized protein
STRINGOPUNC02G29040.17e-96(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32833058
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.11e-26B-box type zinc finger protein with CCT domain