PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Oropetium_20150105_18653A | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 173aa MW: 18991.4 Da PI: 9.3687 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 45.9 | 1.2e-14 | 127 | 169 | 5 | 47 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 +r++r++kNRe+A rsR+RK+a++ eLe+kv Le+eN++Lk Oropetium_20150105_18653A 127 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENERLKR 169 79**************************************995 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 1.4E-14 | 122 | 170 | No hit | No description |
SMART | SM00338 | 1.8E-4 | 123 | 170 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 11.702 | 125 | 170 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 2.4E-12 | 127 | 169 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14707 | 3.97E-25 | 127 | 172 | No hit | No description |
SuperFamily | SSF57959 | 1.56E-10 | 127 | 170 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 130 | 145 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 173 aa Download sequence Send to blast |
MTLEDFLVKA GVVTEGYLKD LNDVGNVDQI GIAGAAGLTG GTQWLDQYQQ QFTAIEPHQH 60 GQHSMPGAYM PSRLALQPLN VGPGAIMESA YSDGNITSPM MGALSDSPTP GRKRGATGDV 120 ADKLMERRQK RMIKNRESAA RSRARKQAYT NELENKVSRL EEENERLKRQ KF* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Oropetium_20150105_18653A |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004970325.1 | 1e-107 | ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
Refseq | XP_022682969.1 | 1e-107 | ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
Swissprot | Q9LES3 | 1e-36 | AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
TrEMBL | A0A0A9HCS1 | 1e-108 | A0A0A9HCS1_ARUDO; Uncharacterized protein | ||||
STRING | Si002173m | 1e-107 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2707 | 38 | 83 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G56850.1 | 1e-38 | ABA-responsive element binding protein 3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Oropetium_20150105_18653A |
Publications ? help Back to Top | |||
---|---|---|---|
|