PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_16846A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family CO-like
Protein Properties Length: 244aa    MW: 26509.1 Da    PI: 6.8312
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_16846AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box201.5e-06742641
                   zf-B_box  6 CpeHeekelqlfCedCqqllCedClleeHkg.Htvvp 41
                               C  +  + +  fC+++   lC  C  + H g H++ p
  Oropetium_20150105_16846A  7 CHSCAAHAAVVFCFNDAAALCVHCDAAAH-GlHRRAP 42
                               99999999*********************.7799877 PP

2CCT57.74.1e-20192235144
                        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                Re+a+lRY eK+k+R F K+i Y+sRK++A++R+RvKGrF+k++
  Oropetium_20150105_16846A 192 RERAKLRYWEKKKNRSFCKQIMYASRKVRADERKRVKGRFAKAS 235
                                99****************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003368.7E-4243IPR000315B-box-type zinc finger
PROSITE profilePS501199.869243IPR000315B-box-type zinc finger
CDDcd000213.47E-51643No hitNo description
PfamPF062032.4E-14192234IPR010402CCT domain
PROSITE profilePS5101713.483192234IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MAPPYACHSC AAHAAVVFCF NDAAALCVHC DAAAHGLHRR APLCDLCGAA PAAVRCDASF  60
MICAGCRPPP AGNLTGGGVA QYTGYPSPAE LVRLLSVEAP PQRQEEFDAW LANQLLLIDD  120
DDPPIISSGT TCDDVTMAVA KIEKLLAGYG PVSTDEDDDQ MLFPPPAADQ TTTPQQQSIT  180
MTEELKKKRE ERERAKLRYW EKKKNRSFCK QIMYASRKVR ADERKRVKGR FAKASDHSAS  240
SHD*
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_16846A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008659424.21e-63zinc finger protein CONSTANS-LIKE 15
TrEMBLA0A1D6NY203e-62A0A1D6NY20_MAIZE; Zinc finger protein CONSTANS-LIKE 12
STRINGPavir.J13712.1.p1e-52(Panicum virgatum)
STRINGPavir.J21550.1.p9e-53(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1410966
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21880.18e-10B-box type zinc finger protein with CCT domain