PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_16131A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family CO-like
Protein Properties Length: 409aa    MW: 44264.2 Da    PI: 4.8924
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_16131AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.81.6e-06445540
                   zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                                C+ +++++   +C+++   lC +C  + H+       Ht++
  Oropetium_20150105_16131A  4 LCDFCGDQRSMVYCRSDAASLCLSCDRNVHSAnalsrrHTRT 45
                               6*****************************657888889876 PP

2zf-B_box20.51e-064789541
                   zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                                C+++ +++    C   ++ lC++C  ++H+       H++++
  Oropetium_20150105_16131A 47 LCDRCTSQPGMVRCLVENVSLCQNCDWNGHSAgsaaagHKRQT 89
                               7*****************************6688999999876 PP

3CCT64.63e-22351394144
                        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                R+ a++RYkeK+++RkF+KkirY+sRKa+A+ R+RvKGrFvk+ 
  Oropetium_20150105_16131A 351 RDSAITRYKEKKQRRKFDKKIRYASRKARADVRKRVKGRFVKAG 394
                                899**************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.897147IPR000315B-box-type zinc finger
SMARTSM003361.3E-10147IPR000315B-box-type zinc finger
CDDcd000213.00E-7447No hitNo description
CDDcd000213.61E-44790No hitNo description
SMARTSM003360.544890IPR000315B-box-type zinc finger
PROSITE profilePS5101715.329351393IPR010402CCT domain
PfamPF062035.8E-17351393IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MGALCDFCGD QRSMVYCRSD AASLCLSCDR NVHSANALSR RHTRTLLCDR CTSQPGMVRC  60
LVENVSLCQN CDWNGHSAGS AAAGHKRQTI NCYSGCPSSA ELSRLWSFVS DIPNVAPEPN  120
CEHGISMMSI SDSGVSNQDN AAGDNSLLDI ASATLMDDLD TRDKVKSLVE SSLGAGVNLL  180
PIGTEPTDGA VDTTTQKVPY MPDKDMFSKD TIYEDFCVDD VDLAFENYEE LFGISHIQTE  240
QLFDDAGIDS YFETKEAHTA SADEQQKLMQ PATSNAISAD SGMSNPGGKG DSSIGIPVRQ  300
ARSSLSLSFS GLTGDSSAGD HQDCVVSSML LMGETPWLPP GPEGSYAGGS RDSAITRYKE  360
KKQRRKFDKK IRYASRKARA DVRKRVKGRF VKAGEAYDYD PLCETRSY*
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_16131A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008658624.10.0uncharacterized protein LOC100282916 isoform X3
SwissprotQ9SSE51e-118COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLA0A3L6DB960.0A0A3L6DB96_MAIZE; Zinc finger protein CONSTANS-LIKE 10
STRINGGRMZM2G013398_P040.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20793788
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48250.17e-85B-box type zinc finger protein with CCT domain