PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_15822A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family ERF
Protein Properties Length: 390aa    MW: 41360.1 Da    PI: 11.2744
Description ERF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_15822AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP238.33.4e-123582251
                        AP2  2 gykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaark 51
                               +y+GVr++   grW +eI  p++ g + r++lg++ t e+Aa a++a ++
  Oropetium_20150105_15822A 35 KYRGVRQRF-FGRWGVEINNPTTAG-NHRVWLGTYETREQAACAYDAVAR 82
                               7********.9*********99955.6*******************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008477.9E-83581IPR001471AP2/ERF domain
Gene3DG3DSA:3.30.730.101.0E-173593IPR001471AP2/ERF domain
PROSITE profilePS5103217.2933595IPR001471AP2/ERF domain
SuperFamilySSF541715.62E-113585IPR016177DNA-binding domain
SMARTSM003801.8E-113599IPR001471AP2/ERF domain
CDDcd000181.81E-123594No hitNo description
PRINTSPR003674.1E-73647IPR001471AP2/ERF domain
PRINTSPR003674.1E-76076IPR001471AP2/ERF domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MEGGGGLRGF ARWAAAKIVA ARDAEGKPPS LPRWKYRGVR QRFFGRWGVE INNPTTAGNH  60
RVWLGTYETR EQAACAYDAV ARTVQQRPRA NLPDPGNEAV RVAVVHAHII DANQKRKRRF  120
RIDEVIRQEA ANMAAARGAV LTAVHPPPAP VAPAGDVLVE SHDKSQRKRK AAGVLENVAP  180
RAVSAVHPPP APAPAGGASA SRSASWAPVG RAEPALLAPV FAPTPLAYCF PEDIGAPPPP  240
AGFHKIAPSP GSIKNISPAA APSPLAPVAP AASWSVHVPD PSRLAFRHFL NTAAATPPPN  300
PSSPLHRAPA PAAGAVPLTP QENREFVARF AALNRSSELR DLHFHNMHRR ARPPVFRAQQ  360
PAPAVVSTVG KPFDLNMPPP LDTDDGHCT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1162168DKSQRKR
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_15822A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1971958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61890.14e-11ERF family protein