PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Oropetium_20150105_14683A

Organism

Oropetium thomaeum

Taxonomic ID

1148796

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium

Family

MIKC_MADS

Protein Properties

Length: 158aa MW: 17954.4 Da PI: 6.122

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Oropetium_20150105_14683A	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	101.2	3.9e-32	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye+ss Oropetium_20150105_14683A 9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSS 59 79***********************************************96 PP
2	K-box	44.2	8.3e-16	58	117	32	91
K-box 32 qreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeen 91 ++qR+llGedL+ L +keL++Le+qL++slk+ + + l+ + e+ +++ e+q+ + Oropetium_20150105_14683A 58 SSTQRNLLGEDLDALGIKELENLEKQLDSSLKHLEESNEVLWQQAWEHGERRQPEVQQLH 117 579*********************************999999999999999999999876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	2.7E-41	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.641	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	5.1E-30	2	62	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.82E-41	2	60	No hit	No description
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.1E-33	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.0E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.1E-33	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.1E-33	38	59	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS51297	6.558	40	129	IPR002487	Transcription factor, K-box
Pfam	PF01486	6.3E-10	56	114	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 158 aa Download sequence Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFSST 60 QRNLLGEDLD ALGIKELENL EKQLDSSLKH LEESNEVLWQ QAWEHGERRQ PEVQQLHGGN 120 VFFHPLDAAG EPTIQMGYPS EAMTSSCITT FLPPWMP*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	9e-21	1	78	1	71	MEF2 CHIMERA
6byy_B	9e-21	1	78	1	71	MEF2 CHIMERA
6byy_C	9e-21	1	78	1	71	MEF2 CHIMERA
6byy_D	9e-21	1	78	1	71	MEF2 CHIMERA
6bz1_A	8e-21	1	78	1	71	MEF2 CHIMERA
6bz1_B	8e-21	1	78	1	71	MEF2 CHIMERA
6bz1_C	8e-21	1	78	1	71	MEF2 CHIMERA
6bz1_D	8e-21	1	78	1	71	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.
UniProt	Probable transcription factor. May be involved in the control of flowering time. {ECO:0000269\|PubMed:9339904, ECO:0000269\|Ref.10}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Oropetium_20150105_14683A

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AJ430692	9e-82	AJ430692.1 Zea mays mRNA for putative MADS-domain transcription factor (m6 gene).
GenBank	BT033360	9e-82	BT033360.1 Zea mays full-length cDNA clone ZM_BFb0092L03 mRNA, complete cds.
GenBank	BT042605	9e-82	BT042605.1 Zea mays full-length cDNA clone ZM_BFb0367C04 mRNA, complete cds.
GenBank	EU959867	9e-82	EU959867.1 Zea mays clone 220179 SRF-type transcription factor family protein mRNA, complete cds.
GenBank	EU960711	9e-82	EU960711.1 Zea mays clone 227805 SRF-type transcription factor family protein mRNA, complete cds.
GenBank	KJ726925	9e-82	KJ726925.1 Zea mays clone pUT3470 MADS transcription factor (MADS6) mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025820791.1	5e-82	MADS-box transcription factor 7-like
Swissprot	P0C5B0	9e-78	MADS7_ORYSI; MADS-box transcription factor 7
Swissprot	Q0J466	9e-78	MADS7_ORYSJ; MADS-box transcription factor 7
TrEMBL	A0A1E5VUD3	2e-84	A0A1E5VUD3_9POAL; MADS-box transcription factor 7
STRING	Sb07g026200.1	2e-81	(Sorghum bicolor)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP3483	34	69

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G24260.3	4e-45	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	Oropetium_20150105_14683A

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Shitsukawa N, et al. Genetic and epigenetic alteration among three homoeologous genes of a class E MADS box gene in hexaploid wheat. Plant Cell, 2007. 19(6): p. 1723-37 [PMID:17586655] Bai X,Wang Q,Chu C Excision of a selective marker in transgenic rice using a novel Cre/loxP system controlled by a floral specific promoter. Transgenic Res., 2008. 17(6): p. 1035-43 [PMID:18437520] Qu L, et al. Expression pattern and functional analysis of a MADS-box gene M79 from rice. Sci. China, C, Life Sci., 2001. 44(2): p. 161-9 [PMID:18726433] Cui R, et al. Functional conservation and diversification of class E floral homeotic genes in rice (Oryza sativa). Plant J., 2010. 61(5): p. 767-81 [PMID:20003164] Li H, et al. The AGL6-like gene OsMADS6 regulates floral organ and meristem identities in rice. Cell Res., 2010. 20(3): p. 299-313 [PMID:20038961] Seok HY, et al. Rice ternary MADS protein complexes containing class B MADS heterodimer. Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604 [PMID:20888318] Tang X, et al. Global gene profiling of laser-captured pollen mother cells indicates molecular pathways and gene subfamilies involved in rice meiosis. Plant Physiol., 2010. 154(4): p. 1855-70 [PMID:20959420] Wang SS,Wang CS,Tseng TH,Hou YL,Chen KY High-resolution genetic mapping and candidate gene identification of the SLP1 locus that controls glume development in rice. Theor. Appl. Genet., 2011. 122(8): p. 1489-96 [PMID:21327937] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Yoshida H Is the lodicule a petal: molecular evidence? Plant Sci., 2012. 184: p. 121-8 [PMID:22284716] Duan Y, et al. Characterization of Osmads6-5, a null allele, reveals that OsMADS6 is a critical regulator for early flower development in rice (Oryza sativa L.). Plant Mol. Biol., 2012. 80(4-5): p. 429-42 [PMID:22933119] Wong CE,Singh MB,Bhalla PL Novel members of the AGAMOUS LIKE 6 subfamily of MIKCC-type MADS-box genes in soybean. BMC Plant Biol., 2013. 13: p. 105 [PMID:23870482] Hu Z,Ding X,Hu S,Sun Y,Xia L Tissue-specifically regulated site-specific excision of selectable marker genes in bivalent insecticidal, genetically-modified rice. Biotechnol. Lett., 2013. 35(12): p. 2177-83 [PMID:23974493] Bai X, et al. Regulatory role of FZP in the determination of panicle branching and spikelet formation in rice. Sci Rep, 2016. 6: p. 19022 [PMID:26744119] Dreni L,Zhang D Flower development: the evolutionary history and functions of the AGL6 subfamily MADS-box genes. J. Exp. Bot., 2016. 67(6): p. 1625-38 [PMID:26956504]