PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_14652A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family CO-like
Protein Properties Length: 477aa    MW: 50761.7 Da    PI: 5.8932
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_14652AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.42.2e-061659340
                   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                               ++ C+ ++e  + l+C+ +   lC  C  + H        H ++
  Oropetium_20150105_14652A 16 QWPCDYCGEAAAALHCRADAARLCVACDRHVHAAnalsrkHVRS 59
                               689*******9*******************99555666667655 PP

2CCT62.81.1e-21424467144
                        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                R +a++RY+eKrk+R++eK+irYesRK +A++R+RvKGrFvk++
  Oropetium_20150105_14652A 424 RGNAMQRYREKRKNRRYEKHIRYESRKLRADTRKRVKGRFVKST 467
                                7789**************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.0E-111461IPR000315B-box-type zinc finger
PROSITE profilePS501199.6981461IPR000315B-box-type zinc finger
CDDcd000214.05E-81761No hitNo description
PfamPF062036.0E-16424466IPR010402CCT domain
PROSITE profilePS5101715.12424466IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MKGAVGGSGG GGARPQWPCD YCGEAAAALH CRADAARLCV ACDRHVHAAN ALSRKHVRSP  60
LCAGCAARPA TSRVACAGAG EPTFLCADCC DGAEDDGCAG APVEGFSGCP SAAELAASWG  120
LDLRGELGYE SDDVEEEDPF FSALDYSMLA VDPDLRDLYV PCDPLEMAAS SGAPPRRLKG  180
EALRHQLAEM ARRDVDAAQP QTHSDLSPRT PRRSSAASSG RLPEKQAPPS LPPEPVPYTS  240
LLMMASTNCP ELVGGGGDRM ADDDEQLLWD CTAPSVPPAQ IWDFNLGRSR DHNEKGEVGF  300
GPNSGGFMIK SYSDMLKEIS SGTTKELEDI YDSRYGAVAE DIMSTNICQL SSKNVSTGSN  360
KRKVSSCTST AIDGPTTSGN HVPASGPLAL TREISFMDQT VAPAAGGVER PAVKLDSETL  420
AQNRGNAMQR YREKRKNRRY EKHIRYESRK LRADTRKRVK GRFVKSTEAL DVSNGG*
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_14652A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004974025.10.0zinc finger protein CONSTANS-LIKE 15
TrEMBLA0A3S6JTZ10.0A0A3S6JTZ1_BAMML; COLO
STRINGSb07g025940.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45042026
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33500.29e-35B-box type zinc finger protein with CCT domain