PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_13880A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family CO-like
Protein Properties Length: 299aa    MW: 30385.3 Da    PI: 5.8646
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_13880AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.73.6e-061860542
                   zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                               +C+ ++   +  +C  +   lC  C  + H        H++vpl
  Oropetium_20150105_13880A 18 CCAVCGGA-AAVYCAADAAALCVPCDAAVHAAnplasrHERVPL 60
                               8******9.*********************66899999999986 PP

2CCT64.53.1e-22198238444
                        CCT   4 allRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                +++RY+eKrktR+F+K+irY+sRKa+Ae RpR+KGrFvk+a
  Oropetium_20150105_13880A 198 RVQRYREKRKTRRFQKTIRYASRKAYAEARPRIKGRFVKRA 238
                                79*************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.5E-111460IPR000315B-box-type zinc finger
PROSITE profilePS501199.4991960IPR000315B-box-type zinc finger
PROSITE profilePS5101715.537195237IPR010402CCT domain
PfamPF062031.1E-16198237IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MMGSEGSTSP VQAGVVACCA VCGGAAAVYC AADAAALCVP CDAAVHAANP LASRHERVPL  60
AEAAMAAASG VYDVDLFAAD DVDAASSWPA LPPTAPGQGH GSPQGSSSTC FSDSGAADGS  120
SLFDLLSDVD LAACVTGSAG HHHPDGAAAP IHNGVAPFWA LPPPGMTGWA AAAWSPADAV  180
VVPXXXXXXX XXXXXXXRVQ RYREKRKTRR FQKTIRYASR KAYAEARPRI KGRFVKRAAA  240
AAASSFDSSD VATAAAAAGD ASAKFWLSFS DAAARDDDDD GVGFYVNAAA AYGVVPSF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_13880A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973094.17e-84zinc finger protein CONSTANS-LIKE 1
TrEMBLK3YJ052e-82K3YJ05_SETIT; Uncharacterized protein
STRINGSi014224m3e-83(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP130662224
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.11e-16CONSTANS-like 5