PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Oropetium_20150105_12105A

Organism

Oropetium thomaeum

Taxonomic ID

1148796

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium

Family

NAC

Protein Properties

Length: 286aa MW: 31634.4 Da PI: 5.9705

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Oropetium_20150105_12105A	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	163.5	7.9e-51	10	137	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWk 84 lppGfrF P+deelv++yL kkv++++ ++ evd++ ePw+Lp ++k + +ewyfFs rd+kyatg+r+nratk+gyWk Oropetium_20150105_12105A 10 LPPGFRFYPSDEELVCHYLYKKVANERAAQ-GTLVEVDLHAREPWELPDAAKLTAREWYFFSFRDRKYATGSRTNRATKTGYWK 92 79***********************776.78***********87788899************************ PP NAM 85 atgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128 atgkd+ev s ++++vg++ktLvfy+grap+g+k+ Wvmhe+rl Oropetium_20150105_12105A 93 ATGKDREVRSPgTRAVVGMRKTLVFYQGRAPNGVKSCWVMHEFRL 137 ******966778*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	6.67E-60	8	156	IPR003441	NAC domain
PROSITE profile	PS51005	58.36	10	156	IPR003441	NAC domain
Pfam	PF02365	1.1E-27	11	137	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 286 aa Download sequence Send to blast
MGLREIESTL PPGFRFYPSD EELVCHYLYK KVANERAAQG TLVEVDLHAR EPWELPDAAK 60 LTAREWYFFS FRDRKYATGS RTNRATKTGY WKATGKDREV RSPGTRAVVG MRKTLVFYQG 120 RAPNGVKSCW VMHEFRLDSP HTPPKEDWVL CRVFQKRKDS EEQDNAGSGS SSPPTFGASS 180 QAVVVLPEQP LTDAYADYHH QSAVGFAPPL DEDPLLNAAI WQYSSVLADQ YPPQEMSSSS 240 PMMMTGLGSR GVGDGCGGFF CYDTAGFEDT AGNIAGMGFP QGWMG*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	7e-51	1	162	4	171	NO APICAL MERISTEM PROTEIN
1ut4_B	7e-51	1	162	4	171	NO APICAL MERISTEM PROTEIN
1ut7_A	7e-51	1	162	4	171	NO APICAL MERISTEM PROTEIN
1ut7_B	7e-51	1	162	4	171	NO APICAL MERISTEM PROTEIN
3swm_A	7e-51	1	162	7	174	NAC domain-containing protein 19
3swm_B	7e-51	1	162	7	174	NAC domain-containing protein 19
3swm_C	7e-51	1	162	7	174	NAC domain-containing protein 19
3swm_D	7e-51	1	162	7	174	NAC domain-containing protein 19
3swp_A	7e-51	1	162	7	174	NAC domain-containing protein 19
3swp_B	7e-51	1	162	7	174	NAC domain-containing protein 19
3swp_C	7e-51	1	162	7	174	NAC domain-containing protein 19
3swp_D	7e-51	1	162	7	174	NAC domain-containing protein 19
4dul_A	7e-51	1	162	4	171	NAC domain-containing protein 19
4dul_B	7e-51	1	162	4	171	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Seems to act as an inhibitor of cell division. {ECO:0000269\|PubMed:10079219, ECO:0000269\|PubMed:10750709, ECO:0000269\|PubMed:11245578, ECO:0000269\|PubMed:12163400, ECO:0000269\|PubMed:12492830, ECO:0000269\|PubMed:12610213, ECO:0000269\|PubMed:12787253, ECO:0000269\|PubMed:14617069, ECO:0000269\|PubMed:15202996, ECO:0000269\|PubMed:15294871, ECO:0000269\|PubMed:15500463, ECO:0000269\|PubMed:15723790, ECO:0000269\|PubMed:16798887, ECO:0000269\|PubMed:17122068, ECO:0000269\|PubMed:17287247, ECO:0000269\|PubMed:9212461}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Oropetium_20150105_12105A

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. Directly induced by ESR2 in response to cytokinins. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269\|PubMed:15202996, ECO:0000269\|PubMed:15294871, ECO:0000269\|PubMed:15723790, ECO:0000269\|PubMed:16854978, ECO:0000269\|PubMed:17056621, ECO:0000269\|PubMed:17287247}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EU966431	0.0	EU966431.1 Zea mays clone 294479 NAC domain-containing protein 21/22 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025824637.1	1e-159	protein CUP-SHAPED COTYLEDON 1-like
Swissprot	Q9FRV4	7e-64	NAC54_ARATH; Protein CUP-SHAPED COTYLEDON 1
TrEMBL	A0A2T7CXR4	1e-158	A0A2T7CXR4_9POAL; Uncharacterized protein
STRING	Pavir.Gb00655.1.p	1e-146	(Panicum virgatum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP697	38	166

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G28530.1	3e-82	NAC domain containing protein 74

Link Out ? help Back to Top
Phytozome	Oropetium_20150105_12105A

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Shinohara N,Ohbayashi I,Sugiyama M Involvement of rRNA biosynthesis in the regulation of CUC1 gene expression and pre-meristematic cell mound formation during shoot regeneration. Front Plant Sci, 2014. 5: p. 159 [PMID:24808900] Kamiuchi Y,Yamamoto K,Furutani M,Tasaka M,Aida M The CUC1 and CUC2 genes promote carpel margin meristem formation during Arabidopsis gynoecium development. Front Plant Sci, 2014. 5: p. 165 [PMID:24817871] Gonçalves B, et al. A conserved role for CUP-SHAPED COTYLEDON genes during ovule development. Plant J., 2015. 83(4): p. 732-42 [PMID:26119568] Cui X, et al. REF6 recognizes a specific DNA sequence to demethylate H3K27me3 and regulate organ boundary formation in Arabidopsis. Nat. Genet., 2016. 48(6): p. 694-9 [PMID:27111035] Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis. Plant J., 2017. 90(3): p. 435-446 [PMID:28161901] Koyama T,Sato F,Ohme-Takagi M Roles of miR319 and TCP Transcription Factors in Leaf Development. Plant Physiol., 2017. 175(2): p. 874-885 [PMID:28842549] González-Carranza ZH, et al. HAWAIIAN SKIRT controls size and floral organ number by modulating CUC1 and CUC2 expression. PLoS ONE, 2017. 12(9): p. e0185106 [PMID:28934292]