PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_12006A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family CO-like
Protein Properties Length: 317aa    MW: 33922.8 Da    PI: 5.7825
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_12006AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box26.51.3e-081957339
                   zf-B_box  3 erkCpeHeeke.lqlfCedCqqllCedCllee.HkgHtv 39
                               +r C+ ++ +  ++l+C+ +  +lC+ C   + H++H +
  Oropetium_20150105_12006A 19 ARPCDACGGEAaARLYCRADAAFLCAGCDARGaHSRHAR 57
                               689*****7555***********************9*75 PP

2zf-B_box24.74.9e-0858103342
                   zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                                 + C+ +e+ ++   C+ +   lC++C   +H+       H++vp+
  Oropetium_20150105_12006A  58 VWLCEVCEHAPAAVTCRADAAALCASCDADIHSAnplarrHERVPV 103
                                679*****************************66899999999986 PP

3CCT69.58.6e-24230273144
                        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                Rea+l+RY+eKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF+k++
  Oropetium_20150105_12006A 230 REARLMRYREKRKSRRFEKTIRYASRKAYAETRPRIKGRFAKRT 273
                                9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.9541760IPR000315B-box-type zinc finger
SMARTSM003361.5E-91760IPR000315B-box-type zinc finger
PfamPF006432.2E-61957IPR000315B-box-type zinc finger
CDDcd000218.79E-82060No hitNo description
Gene3DG3DSA:4.10.45.102.9E-43256IPR000315B-box-type zinc finger
PROSITE profilePS5011910.56656103IPR000315B-box-type zinc finger
PfamPF006432.5E-658103IPR000315B-box-type zinc finger
CDDcd000213.04E-859103No hitNo description
SMARTSM003369.7E-1061103IPR000315B-box-type zinc finger
PfamPF062038.7E-18230272IPR010402CCT domain
PROSITE profilePS5101716.876230272IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MEEGEEKSVV GGSYWGLNAR PCDACGGEAA ARLYCRADAA FLCAGCDARG AHSRHARVWL  60
CEVCEHAPAA VTCRADAAAL CASCDADIHS ANPLARRHER VPVAPFYGAL ADAPKPFASA  120
AKATTGSVVE DDGSNEAEAA SWLLSEPEHG HHQKDGDVFF ADSDTYLDLD FARSMDDIKA  180
IGVQTELDLT GAKLFYPDHS INHSVSSSEA AAVVPDAVAP LPVVSRGRER EARLMRYREK  240
RKSRRFEKTI RYASRKAYAE TRPRIKGRFA KRTSGDALLA VEHDDEMYSS AAAAVAALMA  300
PAADSDYGVD GVVPTF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_12006A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002446734.21e-155zinc finger protein CONSTANS-LIKE 4
SwissprotQ9FHH81e-69COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLC5YBH11e-154C5YBH1_SORBI; Uncharacterized protein
STRINGSb06g021480.11e-151(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21913272
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.11e-41CONSTANS-like 5
Publications ? help Back to Top
  1. Vercruyssen L, et al.
    ANGUSTIFOLIA3 binds to SWI/SNF chromatin remodeling complexes to regulate transcription during Arabidopsis leaf development.
    Plant Cell, 2014. 26(1): p. 210-29
    [PMID:24443518]