PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Oropetium_20150105_09379A | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 162aa MW: 18063.8 Da PI: 10.8384 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 21.8 | 4.5e-07 | 4 | 42 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd l + ++++G g +++ R++ +c+srw++yl Oropetium_20150105_09379A 4 KGKWSKEEDYLMRNHIEKHGIG-------RLQ--RCGRSCRSRWLNYL 42 79******************99.......777..************97 PP | |||||||
2 | Myb_DNA-binding | 37.3 | 6.4e-12 | 49 | 92 | 2 | 47 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 g++T+ Ed+++ d + G+ W+ Ia+ ++ gRt+ +k++w++ Oropetium_20150105_09379A 49 GNFTPAEDKIICDMYSKRGSC-WSVIAAQLP-GRTDLAIKNYWNST 92 89*******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 9.334 | 1 | 42 | IPR017930 | Myb domain |
SMART | SM00717 | 0.0022 | 3 | 44 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 7.81E-23 | 3 | 89 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.5E-13 | 5 | 49 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.05E-5 | 6 | 42 | No hit | No description |
PROSITE profile | PS51294 | 18.901 | 43 | 97 | IPR017930 | Myb domain |
SMART | SM00717 | 4.0E-10 | 47 | 95 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.5E-10 | 49 | 92 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.62E-7 | 50 | 93 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 7.3E-22 | 50 | 96 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 162 aa Download sequence Send to blast |
MMKKGKWSKE EDYLMRNHIE KHGIGRLQRC GRSCRSRWLN YLRPGLKHGN FTPAEDKIIC 60 DMYSKRGSCW SVIAAQLPGR TDLAIKNYWN STLKKRFPAA RTSAAAAAHR KPRPSPTSST 120 SSDAGTPSGT TIFGASTCIL RELNSRAKMG LDNKTEMLRC N* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 5e-23 | 2 | 97 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that functions as regulator of genes affecting cell wall organization and remodeling. Activates genes related to the primary cell wall and represses genes related to the secondary cell wall and expansins. Required for the regulation of longitudinal cell growth in stems, leaves, petioles, roots, flowers and siliques. {ECO:0000269|PubMed:24563287}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Oropetium_20150105_09379A |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014661280.1 | 2e-62 | transcription factor RAX2 | ||||
Swissprot | F4JSU0 | 7e-38 | MYB87_ARATH; Transcription factor MYB87 | ||||
TrEMBL | A0A368SIM7 | 4e-61 | A0A368SIM7_SETIT; Uncharacterized protein | ||||
STRING | Si037244m | 1e-57 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP12228 | 26 | 38 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G37780.1 | 4e-39 | myb domain protein 87 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Oropetium_20150105_09379A |
Publications ? help Back to Top | |||
---|---|---|---|
|