PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Oropetium_20150105_06453A | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 217aa MW: 24954.9 Da PI: 8.4361 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 173.4 | 6.8e-54 | 6 | 133 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgy 82 lppGfrFhPtdeelv++yLk+kv+g ++el ++i+evd+yk+ePw+L k + ++++ewyfF +rd+ky++g r+nrat++gy Oropetium_20150105_06453A 6 LPPGFRFHPTDEELVNYYLKRKVHGLSIEL-DIIPEVDLYKCEPWELAeKsFLPSRDSEWYFFGPRDRKYPNGCRTNRATRAGY 88 79****************************.99**************84335566899************************** PP NAM 83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 Wk+tgkd++v +++ +g+kktLv+ykgrap+g +t Wvmheyr+ Oropetium_20150105_06453A 89 WKSTGKDRRVSY-QNRSIGMKKTLVYYKGRAPQGLRTGWVMHEYRI 133 ***********9.8899***************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 4.05E-63 | 4 | 157 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 59.207 | 6 | 156 | IPR003441 | NAC domain |
Pfam | PF02365 | 5.9E-30 | 7 | 133 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 217 aa Download sequence Send to blast |
MAPADLPPGF RFHPTDEELV NYYLKRKVHG LSIELDIIPE VDLYKCEPWE LAEKSFLPSR 60 DSEWYFFGPR DRKYPNGCRT NRATRAGYWK STGKDRRVSY QNRSIGMKKT LVYYKGRAPQ 120 GLRTGWVMHE YRIEESECDN TMGIQDSYAL CRVFKKNVAF SEIEKQGECS TSKAKGNQEQ 180 PANFGDAGQS SGSNEQSKDN SWMQFIADDL WSNKTK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 3e-54 | 6 | 157 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-54 | 6 | 157 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-54 | 6 | 157 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-54 | 6 | 157 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-54 | 6 | 157 | 20 | 169 | NAC domain-containing protein 19 |
3swm_B | 3e-54 | 6 | 157 | 20 | 169 | NAC domain-containing protein 19 |
3swm_C | 3e-54 | 6 | 157 | 20 | 169 | NAC domain-containing protein 19 |
3swm_D | 3e-54 | 6 | 157 | 20 | 169 | NAC domain-containing protein 19 |
3swp_A | 3e-54 | 6 | 157 | 20 | 169 | NAC domain-containing protein 19 |
3swp_B | 3e-54 | 6 | 157 | 20 | 169 | NAC domain-containing protein 19 |
3swp_C | 3e-54 | 6 | 157 | 20 | 169 | NAC domain-containing protein 19 |
3swp_D | 3e-54 | 6 | 157 | 20 | 169 | NAC domain-containing protein 19 |
4dul_A | 3e-54 | 6 | 157 | 17 | 166 | NAC domain-containing protein 19 |
4dul_B | 3e-54 | 6 | 157 | 17 | 166 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Oropetium_20150105_06453A |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025803497.1 | 1e-145 | NAC domain-containing protein 45-like | ||||
Swissprot | Q9FFI5 | 3e-89 | NAC86_ARATH; NAC domain-containing protein 86 | ||||
TrEMBL | A0A0A9HWW6 | 1e-150 | A0A0A9HWW6_ARUDO; NAC017 | ||||
STRING | Pavir.Bb02626.1.p | 1e-145 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3713 | 38 | 79 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G17730.1 | 1e-110 | NAC domain containing protein 57 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Oropetium_20150105_06453A |
Publications ? help Back to Top | |||
---|---|---|---|
|