PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_02724A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family CO-like
Protein Properties Length: 316aa    MW: 33517.2 Da    PI: 5.1115
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_02724AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.26.7e-081956438
                   zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg....Ht 38
                               r C+ +  ++++l+C+ ++ +lC+ C    H g    H 
  Oropetium_20150105_02724A 19 RPCDACAAEPARLHCRADGAYLCPGCDARAH-GagsrHA 56
                               68**************************999.4466675 PP

2zf-B_box23.51.1e-0758102341
                   zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41 
                                 + C+ +e+ ++   C+ +   lC++C   +H+       H++ p
  Oropetium_20150105_02724A  58 VWLCEVCEHAPAAVTCRADAAALCATCDADIHSAnplarrHERLP 102
                                679*****************************6688888898877 PP

3CCT69.58.4e-24244286143
                        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                                Rea+l+RY+eKrk+R+F+K+irY+sRKa+Ae+RpR+KGrF+k+
  Oropetium_20150105_02724A 244 REARLMRYREKRKNRRFDKTIRYASRKAYAETRPRIKGRFAKR 286
                                9****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003365.2E-41660IPR000315B-box-type zinc finger
PROSITE profilePS501199.7271660IPR000315B-box-type zinc finger
PfamPF006436.1E-61956IPR000315B-box-type zinc finger
CDDcd000213.12E-61960No hitNo description
PROSITE profilePS5011910.49556103IPR000315B-box-type zinc finger
PfamPF006437.1E-658103IPR000315B-box-type zinc finger
CDDcd000213.18E-759103No hitNo description
SMARTSM003361.2E-961103IPR000315B-box-type zinc finger
PROSITE profilePS5101716.916244286IPR010402CCT domain
PfamPF062032.8E-18244286IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MDAAEQKPAA LGYWGVGARP CDACAAEPAR LHCRADGAYL CPGCDARAHG AGSRHARVWL  60
CEVCEHAPAA VTCRADAAAL CATCDADIHS ANPLARRHER LPVAPFFGDA PQQQQPFPSP  120
AFSAAAPGQE EADDDDGSNE AEAASWLLPE PDNSHEDSAT AFFADSDGYL GVDLDFARSM  180
DGIKAIGVPV APPEMDLTGA GAFFYPEHSM NHSVSSSEVA VVPDALAPGA PAAQPAVASK  240
GKEREARLMR YREKRKNRRF DKTIRYASRK AYAETRPRIK GRFAKRCCSA EAEDDDHTVS  300
APAASEGDYG VVPSF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_02724A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020194140.11e-146zinc finger protein CONSTANS-LIKE 3-like
TrEMBLF2DY411e-150F2DY41_HORVV; Predicted protein
STRINGEMT222811e-144(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21913272
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.15e-45CONSTANS-like 5