PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_01559A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 354aa    MW: 38157.5 Da    PI: 4.3856
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_01559AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.74.1e-161663148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WT+eEd +l+  ++++G  +W++ ++  g+ R++k+c++rw +yl
  Oropetium_20150105_01559A 16 KGSWTPEEDMRLIAHIQKYGHANWRALPKQAGLLRCGKSCRLRWINYL 63
                               799*****************************99************97 PP

2Myb_DNA-binding49.21.2e-1569114148
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                rg++T++E++ +++++ +lG++ W++Ia+ ++ gRt++++k+ w+++l
  Oropetium_20150105_01559A  69 RGNFTADEEQTIIKLHGMLGNK-WSKIAASLP-GRTDNEIKNVWNTHL 114
                                89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.6E-24766IPR009057Homeodomain-like
PROSITE profilePS5129414.6441163IPR017930Myb domain
SuperFamilySSF466891.46E-2913110IPR009057Homeodomain-like
SMARTSM007175.6E-131565IPR001005SANT/Myb domain
PfamPF002491.4E-141663IPR001005SANT/Myb domain
CDDcd001674.29E-111863No hitNo description
PROSITE profilePS5129424.84664118IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2567117IPR009057Homeodomain-like
SMARTSM007171.6E-1368116IPR001005SANT/Myb domain
PfamPF002491.6E-1469114IPR001005SANT/Myb domain
CDDcd001672.79E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MGKGRAPCCA KVGLNKGSWT PEEDMRLIAH IQKYGHANWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDLKRG NFTADEEQTI IKLHGMLGNK WSKIAASLPG RTDNEIKNVW NTHLKKRAVT  120
IPSPSPASST TTATTTNWSN GDDSSGEQQS NASKEPDDLL EHLDIPMLDA ACFDFDMLVD  180
PVPELSSYYP SVSAPTSPCA SSSTSQPPAP APPRGGVEDD MLELPPESVD IDQELWSIID  240
ADGGVGIVSE PPAAAAPCHV NATGEADATA ATTSQQNQEE EGNQWWLENL ERELGLWGPM  300
EQDNQYLADP LGVAHPDPLP AMVQDPVNCY FQAGPTTATF PAAGDDGLTS NRM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-281411825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that regulates positively genes involved in anthocyanin biosynthesis such as A1. {ECO:0000269|PubMed:7920701}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00249DAPTransfer from AT1G79180Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_01559A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1119601e-124AK111960.1 Oryza sativa Japonica Group cDNA clone:001-031-D02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025824709.11e-141myb-related protein Zm1-like
SwissprotP200241e-102MYB1_MAIZE; Myb-related protein Zm1
TrEMBLA0A2S3I9V41e-140A0A2S3I9V4_9POAL; Uncharacterized protein
STRINGPavir.Ga00752.1.p1e-140(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.11e-67myb domain protein 63
Publications ? help Back to Top
  1. Franken P,Schrell S,Peterson PA,Saedler H,Wienand U
    Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38.
    Plant J., 1994. 6(1): p. 21-30
    [PMID:7920701]