PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote238051270021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family STAT
Protein Properties Length: 531aa    MW: 59715.8 Da    PI: 5.7985
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote238051270021genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT171.11.9e-5326136318120
                          STAT  18 evvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipklkkypfl 98 
                                   +vvasLlyad+g++ve++ dae+pLL+++dG+e++s+drp+kl++GrasfklkisqLsskcdnrLfri+f+ p+l kypfl
  Ote238051270021|238051270021 261 KVVASLLYADNGIPVENTTDAEPPLLVNCDGIEYASHDRPCKLINGRASFKLKISQLSSKCDNRLFRIMFDAPQLGKYPFL 341
                                   89******************************************************************************* PP

                          STAT  99 eavskpirCisrsrntrssslt 120
                                   ea s pirC+srsr+tr++s t
  Ote238051270021|238051270021 342 EANSLPIRCVSRSRSTRTASIT 363
                                   *****************99876 PP

Sequence ? help Back to Top
Protein Sequence    Length: 531 aa     Download sequence    Send to blast
MSDLSGVVEK DYVLLKNLKV QFRRDDDAGE ADGCFALCFW IYIENCVSYP SAILVQKHPD  60
VTCNVPFLYL DDEKKLKLFP LLFMHKEAPD SDNPIPWREV PCASTEFEFP TKKWVHVGCE  120
GVFCGRHDPW DLKTSLFHLV LLLQEQSLEY IVQEKTNAET WVLRDLMRLH MDGEIVGEKP  180
FTCSFDKDLY AEGLKKLCLT YPDENKDTLH GFVHGLDILF PEAAIKDHYV KDSPLRLTID  240
HSSTSEIEED SDGVWSIVGG KVVASLLYAD NGIPVENTTD AEPPLLVNCD GIEYASHDRP  300
CKLINGRASF KLKISQLSSK CDNRLFRIMF DAPQLGKYPF LEANSLPIRC VSRSRSTRTA  360
SITLRKSSNK TYYGNGCESP SLDDGSMQLM TNIVREAKLS PSSKRIKLGQ DVPLVMIKEA  420
RQASKVHHPH AWTVNQDDNA HAMSIKRRPE DYCGTENNSC ASDNSEATNS DPKSVLSVSS  480
PISDLIIFQY CLGGPAERCH LLKEIAISTT EEQLTHFANQ VSLFSGCSHH R
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011082815.10.0uncharacterized protein LOC105165486
TrEMBLA0A4D8Z7X70.0A0A4D8Z7X7_SALSN; Uncharacterized protein
STRINGMigut.M00685.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA93942325