PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100277210011 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 140aa MW: 15733.7 Da PI: 6.8918 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 46.9 | 6e-15 | 18 | 76 | 5 | 63 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 ++ +r+q+NRe+ArrsR RK++ ++ L v++L +eN + + ++ +++ +l++++ Ote100277210011|100277210011 18 RKRKRMQSNRESARRSRMRKQKHLDDLMAQVAQLHKENAQILSSVDLTTQHFLNLEAQN 76 7889**********************************************999999887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 9.3E-20 | 14 | 78 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 2.4E-11 | 15 | 64 | No hit | No description |
PROSITE profile | PS50217 | 10.921 | 16 | 79 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 8.3E-12 | 17 | 76 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.63E-12 | 18 | 71 | No hit | No description |
CDD | cd14702 | 3.61E-19 | 19 | 69 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 21 | 36 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009845 | Biological Process | seed germination | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 140 aa Download sequence Send to blast |
MASSSGNSAS EEGLMEQRKR KRMQSNRESA RRSRMRKQKH LDDLMAQVAQ LHKENAQILS 60 SVDLTTQHFL NLEAQNSVLR AQMTELAHRL QSLNDILNFV NPAAAGSCMV ESEEGFGEGF 120 FNGSLGLSHH HPIMADMFDY |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the DNA G-box motif 5'-CACGTG-3' of MAN7 promoter. Involved in the positive regulation of seed germination through MAN7 gene activation. MAN7 is required for both, loosening of the micropylar endosperm, and rupture of the seed coat in germinating seeds. {ECO:0000269|PubMed:23461773}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00239 | DAP | Transfer from AT1G75390 | Download |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011083621.1 | 2e-57 | bZIP transcription factor 44 | ||||
Swissprot | C0Z2L5 | 1e-43 | BZP44_ARATH; bZIP transcription factor 44 | ||||
TrEMBL | A0A2G9HZS2 | 5e-50 | A0A2G9HZS2_9LAMI; Uncharacterized protein | ||||
STRING | Migut.C00766.1.p | 4e-50 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA537 | 24 | 123 |
Publications ? help Back to Top | |||
---|---|---|---|
|