PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100275550041 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | Whirly | ||||||||
Protein Properties | Length: 173aa MW: 19371.8 Da PI: 10.0151 | ||||||||
Description | Whirly family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Whirly | 69.6 | 5.5e-22 | 33 | 87 | 1 | 55 |
Whirly 1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsf 55 svyk+kaal+v+++ p+f+ ldsg++kl+++G++ll++a+a ++r+ydW++kq++ Ote100275550041|100275550041 33 SVYKGKAALTVEPRPPEFSPLDSGAFKLSKEGFILLQFAPASGVRQYDWGRKQVY 87 79***************************************************97 PP | |||||||
2 | Whirly | 22 | 2.6e-07 | 144 | 172 | 110 | 138 |
Whirly 110 svtnslvkgnesfsvPvskaefavlrsll 138 v+n++ +++es+++P++kaefavl s + Ote100275550041|100275550041 144 GVQNKIANVDESIYIPITKAEFAVLVSSF 172 599**********************9877 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.30.31.10 | 1.9E-27 | 22 | 87 | IPR009044 | ssDNA-binding transcriptional regulator |
SuperFamily | SSF54447 | 4.71E-32 | 26 | 173 | IPR009044 | ssDNA-binding transcriptional regulator |
Pfam | PF08536 | 6.8E-20 | 34 | 87 | IPR013742 | Plant transcription factor |
Gene3D | G3DSA:2.30.31.10 | 9.5E-5 | 141 | 173 | IPR009044 | ssDNA-binding transcriptional regulator |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 173 aa Download sequence Send to blast |
MLLESWKKCI SFLSIFFICK TGQLPPRVYV GYSVYKGKAA LTVEPRPPEF SPLDSGAFKL 60 SKEGFILLQF APASGVRQYD WGRKQVYLSF ICNLCRYGSS KGISLKPTKM LIWLQFRPIV 120 IIGTGTSAQE TLVNSSMILI KERGVQNKIA NVDESIYIPI TKAEFAVLVS SFN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1l3a_A | 6e-44 | 22 | 173 | 32 | 181 | p24: plant transcriptional regulator PBF-2 |
1l3a_B | 6e-44 | 22 | 173 | 32 | 181 | p24: plant transcriptional regulator PBF-2 |
1l3a_C | 6e-44 | 22 | 173 | 32 | 181 | p24: plant transcriptional regulator PBF-2 |
1l3a_D | 6e-44 | 22 | 173 | 32 | 181 | p24: plant transcriptional regulator PBF-2 |
4koq_A | 3e-44 | 26 | 173 | 7 | 152 | Single-stranded DNA-binding protein WHY3, chloroplastic |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Single-stranded DNA-binding protein that acts as a transcriptional activator of the pathogenesis-related gene PR-10a. Upon elicitation, binds a 30bp promoter sequence known as elicitor element response (ERE) and is required for PR-10a expression. {ECO:0000269|PubMed:10948264, ECO:0000269|PubMed:12080340, ECO:0000269|PubMed:14960277}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011087065.2 | 1e-53 | single-stranded DNA-binding protein WHY1, chloroplastic | ||||
Swissprot | Q9LL85 | 2e-43 | WHY1_SOLTU; Single-stranded DNA-binding protein WHY1, chloroplastic | ||||
TrEMBL | A0A2Z7DFX6 | 2e-54 | A0A2Z7DFX6_9LAMI; DNA-binding protein p24 | ||||
STRING | Migut.L01333.1.p | 3e-50 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA7731 | 24 | 30 |