PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100256320171
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family GRAS
Protein Properties Length: 550aa    MW: 60530 Da    PI: 4.6791
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100256320171genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS64.62e-202063111110
                          GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaal 81 
                                   lv+ L++cAeav++++++ a+alL+++  la +++ +m+++a                      p s    ++s+ + + +
  Ote100256320171|100256320171 206 LVHSLMACAEAVQQNNFKVAEALLKNIGFLAVSQAGAMRKVAXXXXXXXXXXXXXXXXXXXXXYPNS----HDSAFTDMLQ 282
                                   689*****************************************99998888887333333333333....3345555555 PP

                          GRAS  82 klfsevsPilkfshltaNqaIleavegee 110
                                     f+e++P+lkf+h+taNqaIlea++g++
  Ote100256320171|100256320171 283 MHFYETCPYLKFAHFTANQAILEAFAGKN 311
                                   56************************986 PP

2GRAS276.77.2e-85311546137374
                          GRAS 137 egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldes 217
                                   + pp +R+T+vg+p++++++ l+e+g++La++Ae+++v+fe++ lva++l+dl+ + ++++ gE++aVn++++lh ll++ 
  Ote100256320171|100256320171 311 NRPPAFRLTAVGPPSHDNTDHLQEVGRKLAQLAETINVEFEYRGLVANSLADLTASLIQLRDGETVAVNSIFELHPLLARA 391
                                   679***************************************************************************999 PP

                          GRAS 218 vsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl.eaklpreseerikvErellgreivnv 297
                                   +++e     vL+lv +l+P++v+vveqea+hn+  Fl+rf+eal+yys+lfdsl + + +  s+e++++++ +lgr+i+nv
  Ote100256320171|100256320171 392 GAMET----VLQLVGELKPEIVTVVEQEANHNGDIFLDRFTEALHYYSTLFDSLeSCSDGVVSDEDKVMSEIYLGRQICNV 468
                                   99999....*********************************************444555667****************** PP

                          GRAS 298 vacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                   vaceg+er+erhetl++Wr+rl++aGF +v+l+++a+kqa++ll+ ++ + gyrvee++g+l+lgW++rpL+++SaW+
  Ote100256320171|100256320171 469 VACEGEERVERHETLGEWRRRLRAAGFAAVHLGSNAYKQASTLLALFAgGGGYRVEENNGCLMLGWHTRPLIATSAWK 546
                                   ************************************************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512576117No hitNo description
SMARTSM011291.6E-3136109No hitNo description
PfamPF120411.9E-3036103IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098538.119180525IPR005202Transcription factor GRAS
PfamPF035142.5E-82311546IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0042176Biological Processregulation of protein catabolic process
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 550 aa     Download sequence    Send to blast
MKREHINQGN FSSSGSCSSS SKAKMWTAEA DEAEVDELFA ILGYTVKSSD MAEVAQKIEQ  60
LEQVMGSVQQ DGLSQLASET TQYNPSDLSS WLESMISGLN PMPDFDSSSD PFLESSTITS  120
IDNSSVNSCS QMVVDSDFES DLTAIPGKAV YPRAKPPSPP LTKKLXXXXX XXXXXXXXXX  180
FGNSRTSSES TRPVVLVDSQ ENGVRLVHSL MACAEAVQQN NFKVAEALLK NIGFLAVSQA  240
GAMRKVAXXX XXXXXXXXXX XXXXXXXXYP NSHDSAFTDM LQMHFYETCP YLKFAHFTAN  300
QAILEAFAGK NRPPAFRLTA VGPPSHDNTD HLQEVGRKLA QLAETINVEF EYRGLVANSL  360
ADLTASLIQL RDGETVAVNS IFELHPLLAR AGAMETVLQL VGELKPEIVT VVEQEANHNG  420
DIFLDRFTEA LHYYSTLFDS LESCSDGVVS DEDKVMSEIY LGRQICNVVA CEGEERVERH  480
ETLGEWRRRL RAAGFAAVHL GSNAYKQAST LLALFAGGGG YRVEENNGCL MLGWHTRPLI  540
ATSAWKFTSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A1e-4220154514378Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00611ChIP-seqTransfer from AT2G01570Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070609.10.0DELLA protein GAI1
SwissprotQ8S4W70.0GAI1_VITVI; DELLA protein GAI1
TrEMBLA0A2G9HQV20.0A0A2G9HQV2_9LAMI; Uncharacterized protein
STRINGMigut.E00445.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21262462