PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100249000021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family GRAS
Protein Properties Length: 440aa    MW: 49516.6 Da    PI: 5.9513
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100249000021genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS465.62.8e-142474371374
                          GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaal 81 
                                   l++lL++cA++v+s++le a+ +L ++s+laspdgd+mqR+a+y++ ALa r++rs++++ykal++++ s   ++ee++a+
  Ote100249000021|100249000021  47 LIHLLITCANHVASNNLEDANVALDQISHLASPDGDTMQRIASYYAGALADRMLRSWPGVYKALRSTKIS--VVAEEIHAR 125
                                   689*************************************************************999998..6******** PP

                          GRAS  82 klfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetg 162
                                   k+f+e  P++k+++++ NqaI+ea+ ge++vH+iD++++ ++QW aL+++L+sRpegpp+lRiTgv++    ++e le+t+
  Ote100249000021|100249000021 126 KMFFEFLPFMKVAFVISNQAIVEAMVGEKMVHVIDLNATDPTQWCALIRELSSRPEGPPHLRITGVNP----KREVLEQTA 202
                                   ********************************************************************....99******* PP

                          GRAS 163 erLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrll.........................desv 218
                                   + L + Ae+l++pf+fn  v+++ledl++e+Lrvk+gEala+++v+qlh+ll                         ++s 
  Ote100249000021|100249000021 203 HVLIEEAEKLDLPFQFNS-VVTNLEDLDIEKLRVKTGEALAISSVMQLHTLLspskfiglhllekdmvngyspnndsASSS 282
                                   ******************.799***************************************************98765666 PP

                          GRAS 219 sleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvva 299
                                   +l+s +d  L+++++lsPkv+vv+eq++dhn++s++er++e+l++y+alfd+le+ lpr+s er k+E+ ++g+ei++v+a
  Ote100249000021|100249000021 283 PLSS-IDGCLNALWGLSPKVMVVTEQDSDHNGKSLMERLSESLHFYAALFDCLESALPRASIERLKMEKLVFGEEIKDVIA 362
                                   6666.9*************************************************************************** PP

                          GRAS 300 cegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                   cegaer++rhe++ekW++r+e  GF +vpls++a++qak+ll+ ++ dgy+++e++g++v++W+drpL+svSaWr
  Ote100249000021|100249000021 363 CEGAERKQRHEKFEKWSQRFELTGFVNVPLSYYATTQAKRLLQSFNCDGYKIKEDNGCVVICWQDRPLFSVSAWR 437
                                   **************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.04921417IPR005202Transcription factor GRAS
PfamPF035149.7E-14047437IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MFQEDGSSSV TSSPFQMFPT PSSTSSPLTT PYPWLRDLKP EERGLYLIHL LITCANHVAS  60
NNLEDANVAL DQISHLASPD GDTMQRIASY YAGALADRML RSWPGVYKAL RSTKISVVAE  120
EIHARKMFFE FLPFMKVAFV ISNQAIVEAM VGEKMVHVID LNATDPTQWC ALIRELSSRP  180
EGPPHLRITG VNPKREVLEQ TAHVLIEEAE KLDLPFQFNS VVTNLEDLDI EKLRVKTGEA  240
LAISSVMQLH TLLSPSKFIG LHLLEKDMVN GYSPNNDSAS SSPLSSIDGC LNALWGLSPK  300
VMVVTEQDSD HNGKSLMERL SESLHFYAAL FDCLESALPR ASIERLKMEK LVFGEEIKDV  360
IACEGAERKQ RHEKFEKWSQ RFELTGFVNV PLSYYATTQA KRLLQSFNCD GYKIKEDNGC  420
VVICWQDRPL FSVSAWRNRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A3e-71314392380Protein SCARECROW
5b3h_D3e-71314392380Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011080382.10.0scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A4D9BMD50.0A0A4D9BMD5_SALSN; Uncharacterized protein
STRINGPGSC0003DMT4000118390.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]