PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100246530041 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 160aa MW: 18030.7 Da PI: 8.8307 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.4 | 1.4e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT++Ed+ll++++k++G g+W++ ++ g+ R++k+c++rw +yl Ote100246530041|100246530041 14 KGAWTKQEDQLLIQYIKLHGQGCWRSLPKSAGLLRCGKSCRLRWINYL 61 79******************************99************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 5.7E-24 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 22.851 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 2.7E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.7E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 4.97E-22 | 15 | 88 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.58E-12 | 16 | 61 | No hit | No description |
PROSITE profile | PS50090 | 4.077 | 62 | 86 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 6.0E-9 | 65 | 88 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 160 aa Download sequence Send to blast |
MGRSPCCEKE HTNKGAWTKQ EDQLLIQYIK LHGQGCWRSL PKSAGLLRCG KSCRLRWINY 60 LRPDLKRGNF SQQEDELIIS LHSLLGNKKL ISSGIDPQTH THSINPKTLA MQALSNDVGF 120 RVIAAAEEEE YSRCSSYGVL SGNLLHPQIN LELSIRPPHL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 9e-15 | 13 | 88 | 26 | 100 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the negative regulation of flavonol biosynthesis. Represses the early phenylpropanoid genes, phenylalanine ammonia-lyase (PAL), cinnamate 4-hydroxylase (C4H) and 4-coumarate-CoA ligase (4CL), as well as the flavonoid-specific genes, flavonoid 3'-hydroxylase (F3'H) and dihydroflavonol 4-reductase (DFR) (PubMed:24319076). Plays a role in seed germination inhibition. Negatively regulates the expression of the abscisic acid (ABA) signaling transcription factor ABI5 in seeds (PubMed:25053018). {ECO:0000269|PubMed:24319076, ECO:0000269|PubMed:25053018}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA) and osmotic stress (PubMed:25053018). Induced by salt stress (PubMed:24319076, PubMed:25053018). {ECO:0000269|PubMed:24319076, ECO:0000269|PubMed:25053018}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011097098.1 | 5e-60 | myb-related protein 308 | ||||
Refseq | XP_020215096.1 | 3e-60 | myb-related protein 308 | ||||
Swissprot | Q42379 | 4e-57 | MYB7_ARATH; Transcription factor MYB7 | ||||
TrEMBL | A0A059PSK2 | 7e-69 | A0A059PSK2_SALMI; MYB-related transcription factor | ||||
STRING | VIT_07s0130g00040.t01 | 8e-59 | (Vitis vinifera) | ||||
STRING | Migut.L00379.1.p | 3e-59 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |