PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100245980001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 91aa MW: 10556.2 Da PI: 10.5812 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 102.2 | 1.9e-32 | 25 | 75 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey++ Ote100245980001|100245980001 25 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN 75 79***********************************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 33.543 | 17 | 77 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.4E-41 | 17 | 76 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 6.67E-31 | 18 | 85 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 7.75E-38 | 18 | 76 | No hit | No description |
PRINTS | PR00404 | 6.0E-34 | 19 | 39 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 19 | 73 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.2E-27 | 26 | 73 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.0E-34 | 39 | 54 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.0E-34 | 54 | 75 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 91 aa Download sequence Send to blast |
MELQSDQSRE MSSERKIGRG KIEIKRIENT TNRQVTFCKR RNGLLKKAYE LSVLCDAEVA 60 LIVFSSRGRL YEYANNRQCV RILGKNLSSR T |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 3e-21 | 17 | 76 | 1 | 60 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 3e-21 | 17 | 76 | 1 | 60 | Myocyte-specific enhancer factor 2B |
1tqe_R | 3e-21 | 17 | 76 | 1 | 60 | Myocyte-specific enhancer factor 2B |
1tqe_S | 3e-21 | 17 | 76 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_A | 3e-21 | 17 | 76 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_B | 3e-21 | 17 | 76 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_C | 3e-21 | 17 | 76 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_D | 3e-21 | 17 | 76 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_E | 3e-21 | 17 | 76 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_F | 3e-21 | 17 | 76 | 1 | 60 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011085305.1 | 2e-45 | floral homeotic protein AGAMOUS-like isoform X1 | ||||
Refseq | XP_011085306.1 | 2e-45 | floral homeotic protein AGAMOUS-like isoform X1 | ||||
Refseq | XP_011085307.1 | 2e-45 | floral homeotic protein AGAMOUS-like isoform X2 | ||||
Refseq | XP_011085308.1 | 2e-45 | floral homeotic protein AGAMOUS-like isoform X3 | ||||
Refseq | XP_011085309.1 | 2e-45 | floral homeotic protein AGAMOUS-like isoform X4 | ||||
Refseq | XP_019169239.1 | 2e-45 | PREDICTED: floral homeotic protein AGAMOUS isoform X1 | ||||
Refseq | XP_019169240.1 | 2e-45 | PREDICTED: floral homeotic protein AGAMOUS isoform X1 | ||||
Refseq | XP_019169242.1 | 2e-45 | PREDICTED: floral homeotic protein AGAMOUS isoform X2 | ||||
Refseq | XP_020551391.1 | 2e-45 | floral homeotic protein AGAMOUS-like isoform X1 | ||||
Swissprot | Q40885 | 3e-44 | AG_PETHY; Floral homeotic protein AGAMOUS | ||||
TrEMBL | A0A4D8ZQW9 | 2e-44 | A0A4D8ZQW9_SALSN; MADS-box transcription factor, plant | ||||
TrEMBL | A0A4D9AML1 | 3e-44 | A0A4D9AML1_SALSN; MADS-box transcription factor, plant | ||||
STRING | Migut.M00986.1.p | 4e-43 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA40 | 24 | 625 |
Publications ? help Back to Top | |||
---|---|---|---|
|