PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100239830061 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 117aa MW: 13579.2 Da PI: 11.1709 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.8 | 1.1e-17 | 22 | 67 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l Ote100239830061|100239830061 22 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 67 89********************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50090 | 4.426 | 1 | 16 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 2.2E-11 | 2 | 29 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.25E-21 | 3 | 76 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 25.891 | 17 | 71 | IPR017930 | Myb domain |
SMART | SM00717 | 1.2E-16 | 21 | 69 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.8E-17 | 22 | 67 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 8.19E-12 | 24 | 67 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 5.5E-23 | 30 | 68 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 117 aa Download sequence Send to blast |
LQRCGKSCRL RWTNYLRPDI KRGKFSLQEE QTIIQLHALL GNRWSAIATH LPKRTDNEIK 60 NYWNTHLKKR LAKMGIDPVT HKPKXXXXXX XXXXQETPPI SATWPSGRAP ASRPKPD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-19 | 3 | 71 | 40 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the control of epidermal cell morphogenesis in petals. Promotes unidirectional cell expansion once outgrowth has been initiated (PubMed:17376813). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). Functions as a major regulator of cuticle formation in vegetative organs by regulating the cuticle biosynthesis genes CYP86A8/LCR and CER1 (PubMed:24169067). {ECO:0000269|PubMed:17376813, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020168407.1 | 3e-56 | myb-related protein Myb4-like | ||||
Refseq | XP_021318372.1 | 4e-56 | transcription factor MYB16 | ||||
Refseq | XP_023929587.1 | 1e-56 | transcription factor MYB106-like, partial | ||||
Swissprot | Q9LXF1 | 6e-55 | MYB16_ARATH; Transcription factor MYB16 | ||||
TrEMBL | A0A3B6B0M5 | 6e-55 | A0A3B6B0M5_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A3B6C869 | 5e-55 | A0A3B6C869_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A446L6I1 | 5e-55 | A0A446L6I1_TRITD; Uncharacterized protein | ||||
TrEMBL | A0A446MFC9 | 5e-55 | A0A446MFC9_TRITD; Uncharacterized protein | ||||
TrEMBL | A0A453C549 | 4e-55 | A0A453C549_AEGTS; Uncharacterized protein | ||||
TrEMBL | L7XG84 | 5e-55 | L7XG84_9LAMI; Mixta-like 2.2 protein (Fragment) | ||||
STRING | XP_008366447.1 | 1e-55 | (Malus domestica) | ||||
STRING | Si010352m | 2e-55 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Publications ? help Back to Top | |||
---|---|---|---|
|