PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Ote100239830061

Organism

Ocimum tenuiflorum

Taxonomic ID

204149

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum

Family

MYB_related

Protein Properties

Length: 117aa MW: 13579.2 Da PI: 11.1709

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Ote100239830061	genome	OteDB	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.8	1.1e-17	22	67	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l Ote100239830061\|100239830061 22 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 67 89******************.*****.**********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50090	4.426	1	16	IPR017877	Myb-like domain
Gene3D	G3DSA:1.10.10.60	2.2E-11	2	29	IPR009057	Homeodomain-like
SuperFamily	SSF46689	1.25E-21	3	76	IPR009057	Homeodomain-like
PROSITE profile	PS51294	25.891	17	71	IPR017930	Myb domain
SMART	SM00717	1.2E-16	21	69	IPR001005	SANT/Myb domain
Pfam	PF00249	5.8E-17	22	67	IPR001005	SANT/Myb domain
CDD	cd00167	8.19E-12	24	67	No hit	No description
Gene3D	G3DSA:1.10.10.60	5.5E-23	30	68	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 117 aa Download sequence Send to blast
LQRCGKSCRL RWTNYLRPDI KRGKFSLQEE QTIIQLHALL GNRWSAIATH LPKRTDNEIK 60 NYWNTHLKKR LAKMGIDPVT HKPKXXXXXX XXXXQETPPI SATWPSGRAP ASRPKPD

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	2e-19	3	71	40	108	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the control of epidermal cell morphogenesis in petals. Promotes unidirectional cell expansion once outgrowth has been initiated (PubMed:17376813). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). Functions as a major regulator of cuticle formation in vegetative organs by regulating the cuticle biosynthesis genes CYP86A8/LCR and CER1 (PubMed:24169067). {ECO:0000269\|PubMed:17376813, ECO:0000269\|PubMed:23709630, ECO:0000269\|PubMed:24169067}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020168407.1	3e-56	myb-related protein Myb4-like
Refseq	XP_021318372.1	4e-56	transcription factor MYB16
Refseq	XP_023929587.1	1e-56	transcription factor MYB106-like, partial
Swissprot	Q9LXF1	6e-55	MYB16_ARATH; Transcription factor MYB16
TrEMBL	A0A3B6B0M5	6e-55	A0A3B6B0M5_WHEAT; Uncharacterized protein
TrEMBL	A0A3B6C869	5e-55	A0A3B6C869_WHEAT; Uncharacterized protein
TrEMBL	A0A446L6I1	5e-55	A0A446L6I1_TRITD; Uncharacterized protein
TrEMBL	A0A446MFC9	5e-55	A0A446MFC9_TRITD; Uncharacterized protein
TrEMBL	A0A453C549	4e-55	A0A453C549_AEGTS; Uncharacterized protein
TrEMBL	L7XG84	5e-55	L7XG84_9LAMI; Mixta-like 2.2 protein (Fragment)
STRING	XP_008366447.1	1e-55	(Malus domestica)
STRING	Si010352m	2e-55	(Setaria italica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12	24	2154

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Huang BH, et al. Positive selection and functional divergence of R2R3-MYB paralogous genes expressed in inflorescence buds of Scutellaria species (Labiatae). Int J Mol Sci, 2015. 16(3): p. 5900-21 [PMID:25782156] Cui F, et al. Dissecting Abscisic Acid Signaling Pathways Involved in Cuticle Formation. Mol Plant, 2016. 9(6): p. 926-38 [PMID:27060495]