PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100238290011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family MYB_related
Protein Properties Length: 269aa    MW: 29541.2 Da    PI: 7.6713
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100238290011genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.44.6e-201459147
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                  +g+W++eEd+ll ++v+++G+++W++I++ ++ gR++k+c++rw + 
  Ote100238290011|100238290011 14 KGPWSPEEDDLLQKLVEKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 59
                                  79******************************.***********985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.334964IPR017930Myb domain
SuperFamilySSF466892.95E-211186IPR009057Homeodomain-like
SMARTSM007173.9E-181362IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-221359IPR009057Homeodomain-like
PfamPF002495.5E-201459IPR001005SANT/Myb domain
CDDcd001671.74E-171658No hitNo description
Gene3DG3DSA:1.10.10.608.0E-66085IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MAATAQQSEA DRTKGPWSPE EDDLLQKLVE KHGPRNWSLI SKSIPGRSGK SCRLRWCNQL  60
SPQVEHRAFT PEEDETIIRA HARFARQPLK RSASVGPGTN ISASAFCFNP GSPDGSDMSE  120
SSHSGHLVYR PIARTGGISP PERQLDPVTS LSLSLPGFDP NPGHSTGLDL DPQIVTEPSI  180
SMLPKHSVQP LASHPPSPPQ SSVQNHQFGQ PTAEKQFFSE EFLRVMQEMV RKEVHNYMAG  240
VQPNGFSACM QSEAIRNAMV KRMGISKID
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-2014109498C-Myb DNA-Binding Domain
1msf_C1e-2014109498C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012851720.11e-115PREDICTED: transcription factor MYB44-like
TrEMBLA0A059PRP01e-136A0A059PRP0_SALMI; MYB-related transcription factor
STRINGMigut.C00524.1.p1e-115(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15862471