PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100231490081 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 146aa MW: 17101.9 Da PI: 9.9045 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 123 | 2.6e-38 | 15 | 135 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 lp GfrFhPtdeel+ +yLk+k+ + +l++ +vi+e++ ++++PwdLp ++ +++ yfF+kr++ + ++ +n +t+ g Ote100231490081|100231490081 15 LPIGFRFHPTDEELLIHYLKRKILSLPLPA-SVIPEFEAFQLNPWDLPGEL---KEKKYFFCKRRRISMNKCSSNFSTDCG 91 699***************************.99***************554...4578*********************** PP NAM 82 yWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 yWk+tgkdk+++ + ++g+kk+++fy+gr+ k t+W+m+ey+l Ote100231490081|100231490081 92 YWKSTGKDKQIMGGANYVIGIKKSFAFYQGRNLK---TQWIMQEYSL 135 *************99999**********988866...********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.44E-41 | 12 | 139 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 40.716 | 15 | 146 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.2E-24 | 16 | 135 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 146 aa Download sequence Send to blast |
MERARTEDEK EGVKLPIGFR FHPTDEELLI HYLKRKILSL PLPASVIPEF EAFQLNPWDL 60 PGELKEKKYF FCKRRRISMN KCSSNFSTDC GYWKSTGKDK QIMGGANYVI GIKKSFAFYQ 120 GRNLKTQWIM QEYSLVGHLK TPFLTQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 3e-30 | 5 | 135 | 5 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012844037.1 | 2e-69 | PREDICTED: NAC domain-containing protein 68 | ||||
Swissprot | Q9FY93 | 8e-42 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | A0A2G9G906 | 4e-69 | A0A2G9G906_9LAMI; Uncharacterized protein | ||||
STRING | Migut.F00031.1.p | 7e-69 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA13250 | 13 | 18 |
Publications ? help Back to Top | |||
---|---|---|---|
|