PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100227540031 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 137aa MW: 15860.1 Da PI: 10.5411 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 163.9 | 5.6e-51 | 13 | 137 | 1 | 124 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknrat 78 +ppGfrFhPtdeel+++yLkkkv+ +k+++ +vi+evd++k+ePwdL++++k ++ewyfFs++d+ky+tg+r+nrat Ote100227540031|100227540031 13 VPPGFRFHPTDEELLHFYLKKKVTFQKFDM-DVIREVDLNKIEPWDLQERCKIgstPQNEWYFFSHKDRKYPTGSRTNRAT 92 69****************************.99**************964444222455********************** PP NAM 79 ksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmh 124 ++g+Wkatg+dk + + + +++g++ktLvfy+grap+g+ktdW+mh Ote100227540031|100227540031 93 SAGFWKATGRDKCIRN-TFKKIGMRKTLVFYRGRAPHGQKTDWIMH 137 ***************9.8899************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 4.97E-51 | 11 | 137 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 50.096 | 13 | 137 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.9E-25 | 14 | 137 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 137 aa Download sequence Send to blast |
MAAGSSSGGG GGVPPGFRFH PTDEELLHFY LKKKVTFQKF DMDVIREVDL NKIEPWDLQE 60 RCKIGSTPQN EWYFFSHKDR KYPTGSRTNR ATSAGFWKAT GRDKCIRNTF KKIGMRKTLV 120 FYRGRAPHGQ KTDWIMH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 4e-46 | 13 | 137 | 15 | 136 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator. Together with BRN1 and SMB, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:20197506}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009757635.1 | 8e-91 | PREDICTED: protein BEARSKIN1 | ||||
Refseq | XP_023523840.1 | 2e-90 | protein BEARSKIN2-like | ||||
Swissprot | Q9SV87 | 1e-88 | BRN2_ARATH; Protein BEARSKIN2 | ||||
TrEMBL | A0A103XWK6 | 5e-89 | A0A103XWK6_CYNCS; No apical meristem (NAM) protein | ||||
TrEMBL | A0A1S3X3A6 | 2e-88 | A0A1S3X3A6_TOBAC; protein BEARSKIN2-like | ||||
TrEMBL | A0A1U7V7B1 | 2e-89 | A0A1U7V7B1_NICSY; protein BEARSKIN1 | ||||
TrEMBL | A0A251T1N5 | 2e-88 | A0A251T1N5_HELAN; Putative NAC domain containing protein 70 | ||||
STRING | XP_004506361.1 | 4e-89 | (Cicer arietinum) | ||||
STRING | XP_009757635.1 | 3e-90 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA134 | 24 | 297 |
Publications ? help Back to Top | |||
---|---|---|---|
|