PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100212130111 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | SRS | ||||||||
Protein Properties | Length: 147aa MW: 15274 Da PI: 4.7881 | ||||||||
Description | SRS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF702 | 85.4 | 1.4e-26 | 28 | 90 | 91 | 154 |
DUF702 91 lssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154 +ss+++ l ++slP +v+++avf+cv+v+++ddg++e+aYq++v igGhvfkG+LydqG e+ Ote100212130111|100212130111 28 TSSSHQDAGL-KESLPGQVRAPAVFKCVKVTAIDDGDDEYAYQAVVRIGGHVFKGFLYDQGFEA 90 3444433333.455***********************************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05142 | 6.1E-24 | 29 | 89 | IPR007818 | Protein of unknown function DUF702 |
TIGRFAMs | TIGR01624 | 6.4E-30 | 41 | 87 | IPR006511 | Lateral Root Primordium type 1, C-terminal |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 147 aa Download sequence Send to blast |
PRLGGASQXX XXXXXXXXXX XXXRSFDTSS SHQDAGLKES LPGQVRAPAV FKCVKVTAID 60 DGDDEYAYQA VVRIGGHVFK GFLYDQGFEA REGFPDISEL QLGAVGGGSG GGRNGASSSH 120 PVLDPSDIFA ASGGGLLGGS SYGNQIN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influence vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). Modulates root growth. {ECO:0000269|PubMed:16740146, ECO:0000269|PubMed:18835563}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Expression repressed by LDL1 via histone H3 and H4 deacetylation. {ECO:0000269|PubMed:18835563}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008363042.2 | 1e-57 | protein LATERAL ROOT PRIMORDIUM 1 | ||||
Swissprot | Q94CK9 | 5e-42 | LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1 | ||||
TrEMBL | A0A498KCA6 | 4e-56 | A0A498KCA6_MALDO; Uncharacterized protein | ||||
STRING | XP_008363042.1 | 4e-57 | (Malus domestica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA7655 | 23 | 31 |
Publications ? help Back to Top | |||
---|---|---|---|
|