PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100202690041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family M-type_MADS
Protein Properties Length: 87aa    MW: 9940.41 Da    PI: 11.0059
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100202690041genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.42.6e-30959151
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                  krien + rqvtfskRrng+lKKA+ELSvLC+aeva+i+fs++g+lye+ss
  Ote100202690041|100202690041  9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCEAEVALIVFSQKGRLYEFSS 59
                                  79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.903161IPR002100Transcription factor, MADS-box
SMARTSM004322.4E-39160IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.67E-29361IPR002100Transcription factor, MADS-box
CDDcd002654.52E-35357No hitNo description
PRINTSPR004041.8E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.0E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-313859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 87 aa     Download sequence    Send to blast
MVRGKVEMKR IENATSRQVT FSKRRNGLLK KAFELSVLCE AEVALIVFSQ KGRLYEFSSS  60
KSVSSPXXXX XXXXXXXXXP IFLQLTK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-17160160Myocyte-specific enhancer factor 2B
1tqe_Q2e-17160160Myocyte-specific enhancer factor 2B
1tqe_R2e-17160160Myocyte-specific enhancer factor 2B
1tqe_S2e-17160160Myocyte-specific enhancer factor 2B
6c9l_A2e-17160160Myocyte-specific enhancer factor 2B
6c9l_B2e-17160160Myocyte-specific enhancer factor 2B
6c9l_C2e-17160160Myocyte-specific enhancer factor 2B
6c9l_D2e-17160160Myocyte-specific enhancer factor 2B
6c9l_E2e-17160160Myocyte-specific enhancer factor 2B
6c9l_F2e-17160160Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that regulates root development by controlling meristem size and patterning of the root apical meristem. Regulates auxin transport and gradients in the root meristematic cells via direct regulation of the auxin efflux carrier PIN1 and PIN4 gene expression. Binds specifically to the CArG-box DNA sequences in the promoter regions of PIN1 and PIN4 genes (PubMed:24121311). Involved in the regulation of shoot apical meristem (SAM) cell identities and transitions. Promotes flowering transition and participates in flower meristem maintenance and determinacy. Positively regulates TFL1 and WUS expression. Binds directly to the TFL1 regulatory sequences (PubMed:25636918). {ECO:0000269|PubMed:24121311}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin. {ECO:0000269|PubMed:24121311}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021804055.14e-34MADS-box protein AGL42-like
RefseqXP_021804056.14e-34MADS-box protein AGL42-like
RefseqXP_021804057.14e-34MADS-box protein AGL42-like
SwissprotQ388388e-33AGL14_ARATH; Agamous-like MADS-box protein AGL14
TrEMBLA0A438CUW38e-33A0A438CUW3_VITVI; MADS-box protein AGL42
STRINGVIT_16s0022g02400.t018e-33(Vitis vinifera)
STRINGevm.model.supercontig_4.2046e-33(Carica papaya)
STRINGEMJ223381e-32(Prunus persica)
STRINGXP_004308127.13e-32(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Publications ? help Back to Top
  1. Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W
    GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox.
    Plant Physiol., 2004. 136(1): p. 2621-32
    [PMID:15375207]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Qu Y, et al.
    Peroxisomal CuAOζ and its product H2O2 regulate the distribution of auxin and IBA-dependent lateral root development in Arabidopsis.
    J. Exp. Bot., 2017. 68(17): p. 4851-4867
    [PMID:28992128]