PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100199140051 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 178aa MW: 19168.1 Da PI: 7.699 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 33.6 | 8.4e-11 | 111 | 165 | 7 | 62 |
HHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 7 errkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 e ++ k R++A+ R+RKka++ Le +vkeLe++N +L ++l++ ++e++ l++ Ote100199140051|100199140051 111 ENKRLK-RVSAQQARERKKAYLIDLEARVKELETKNAELEERLSTVQNESQMLRQI 165 445555.9*******************************************99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50217 | 9.668 | 106 | 169 | IPR004827 | Basic-leucine zipper domain |
SMART | SM00338 | 1.4E-9 | 106 | 168 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 5.1E-9 | 111 | 166 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14704 | 3.85E-12 | 113 | 160 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 1.6E-11 | 117 | 168 | No hit | No description |
SuperFamily | SSF57959 | 1.31E-8 | 117 | 166 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0009740 | Biological Process | gibberellic acid mediated signaling pathway | ||||
GO:0010017 | Biological Process | red or far-red light signaling pathway | ||||
GO:0010099 | Biological Process | regulation of photomorphogenesis | ||||
GO:0010114 | Biological Process | response to red light | ||||
GO:0010218 | Biological Process | response to far red light | ||||
GO:0010224 | Biological Process | response to UV-B | ||||
GO:0031539 | Biological Process | positive regulation of anthocyanin metabolic process | ||||
GO:0042753 | Biological Process | positive regulation of circadian rhythm | ||||
GO:0080167 | Biological Process | response to karrikin | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003690 | Molecular Function | double-stranded DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 178 aa Download sequence Send to blast |
MEHVMAQNTA TLIDSSPSDQ NRSNGEMQEQ ATSSIAASSL PSSSERSSSS ALHAEVKEGM 60 ESDDEIRRVP EIGGEAAGAT TSGREGGSVV GITQPAAGGS KKRGRSPADK ENKRLKRVSA 120 QQARERKKAY LIDLEARVKE LETKNAELEE RLSTVQNESQ MLRQILKNTT AGSQEGRK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes. {ECO:0000269|PubMed:15178762}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00117 | ampDAP | Transfer from AT5G11260 | Download |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011081579.1 | 5e-79 | transcription factor HY5 isoform X1 | ||||
Swissprot | Q9SM50 | 8e-75 | HY5_SOLLC; Transcription factor HY5 | ||||
TrEMBL | A0A2G9I2K8 | 2e-76 | A0A2G9I2K8_9LAMI; Uncharacterized protein | ||||
TrEMBL | A0A4D8YDQ0 | 2e-76 | A0A4D8YDQ0_SALSN; Transcription factor HY5 | ||||
STRING | Migut.E01790.1.p | 6e-74 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA8037 | 24 | 30 |
Publications ? help Back to Top | |||
---|---|---|---|
|