PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100192040001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family GRAS
Protein Properties Length: 257aa    MW: 28594.9 Da    PI: 9.8139
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100192040001genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS248.92e-76202571242
                          GRAS   1 lvelLlecAeavssgdle........laqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn 73 
                                   lv++L++cAeav++++++            l++++  la ++  +m+++a+yf+eALa+r+++    +y    p+      
  Ote100192040001|100192040001  20 LVHTLMACAEAVQQEKMKlxxxxxxxXXXXLVKQVGLLAVSQVGAMRKVATYFAEALARRVYK----IY----PTXXXXXX 92 
                                   689***********99985555555566789*******************************9....55....44444444 PP

                          GRAS  74 sseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgs 154
                                    s+ l++   f+e+ P+lkf+h+taNqaIlea++g +rvH+iDf++ qG+QWpaL+qaLa Rp+gpp +R+Tg+g+p++++
  Ote100192040001|100192040001  93 YSDILHM--HFYETGPYLKFAHFTANQAILEAFAGTNRVHVIDFSLRQGMQWPALMQALALRPGGPPAFRLTGIGPPQPDN 171
                                   6777776..4*********************************************************************** PP

                          GRAS 155 keeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvks 233
                                   +++l+++g++La++Ae++gv+fef+ lv+++l+dl++++L+++p   E++aVn+v++lhrll+++ ++e+    vL+ +ks
  Ote100192040001|100192040001 172 SDALQQVGWKLAQVAEAIGVEFEFRGLVTNSLADLDVKMLDIRPggVETVAVNSVFELHRLLARPRAMEK----VLDSIKS 248
                                   ********************************************888***************99999999....******* PP

                          GRAS 234 lsPkvvvvv 242
                                   +sPk+v+vv
  Ote100192040001|100192040001 249 MSPKIVTVV 257
                                   *******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.5911257IPR005202Transcription factor GRAS
PfamPF035146.9E-7420257IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MAILQRRXVL VDSQDTGVRL VHTLMACAEA VQQEKMKLXX XXXXXXXXXL VKQVGLLAVS  60
QVGAMRKVAT YFAEALARRV YKIYPTXXXX XXYSDILHMH FYETGPYLKF AHFTANQAIL  120
EAFAGTNRVH VIDFSLRQGM QWPALMQALA LRPGGPPAFR LTGIGPPQPD NSDALQQVGW  180
KLAQVAEAIG VEFEFRGLVT NSLADLDVKM LDIRPGGVET VAVNSVFELH RLLARPRAME  240
KVLDSIKSMS PKIVTVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A6e-322725726249Protein SCARECROW
5b3h_A6e-322725725248Protein SCARECROW
5b3h_D6e-322725725248Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway (By similarity). Its degradation is not essential for germination. {ECO:0000250, ECO:0000269|PubMed:15347801}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011097451.11e-139DELLA protein GAI
RefseqXP_012838438.11e-139PREDICTED: DELLA protein GAI-like
RefseqXP_027074537.11e-138DELLA protein GAI-like
RefseqXP_027078270.11e-138DELLA protein GAI-like
RefseqXP_027178624.11e-138DELLA protein GAI-like
SwissprotQ7Y1B61e-138GAI_SOLLC; DELLA protein GAI
TrEMBLA0A4D8YZF21e-144A0A4D8YZF2_SALSN; DELLA protein
STRINGMigut.K00894.1.p1e-138(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21262462
Publications ? help Back to Top
  1. Nir I, et al.
    The Tomato DELLA Protein PROCERA Acts in Guard Cells to Promote Stomatal Closure.
    Plant Cell, 2017. 29(12): p. 3186-3197
    [PMID:29150547]