PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100187770001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 160aa MW: 18178.5 Da PI: 9.5957 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 123.2 | 9e-39 | 43 | 101 | 2 | 60 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 +ek+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk k Ote100187770001|100187770001 43 PEKIIQCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKAKP 101 7899****************************************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 6.0E-28 | 42 | 100 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 2.5E-32 | 45 | 100 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 27.978 | 47 | 101 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 49 | 85 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 160 aa Download sequence Send to blast |
MAQVQENNTS SGIKLFGATI SPKQRSQDHD RIDKSDPTAE KKPEKIIQCP RCKSMETKFC 60 YFNNYNVNQP RHFCKGCQRY WTAGGALRNV PVGAGRRKAK PPCRPGMPAF SEGCLFDAAA 120 GVQQLDXXXX XXXXXXXXXX XXXXXXXXXX XXXXXEMRYQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Acts as a negative regulator in the phytochrome-mediated light responses. Controls phyB-mediated end-of-day response and the phyA-mediated anthocyanin accumulation. Not involved in direct flowering time regulation. {ECO:0000269|PubMed:19619493}. | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By red or far-red light. Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. | |||||
UniProt | INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011085996.1 | 1e-63 | dof zinc finger protein DOF1.5-like | ||||
Swissprot | O22967 | 1e-45 | CDF4_ARATH; Cyclic dof factor 4 | ||||
Swissprot | P68350 | 1e-45 | DOF15_ARATH; Dof zinc finger protein DOF1.5 | ||||
TrEMBL | A0A2G9H6E4 | 7e-60 | A0A2G9H6E4_9LAMI; Uncharacterized protein | ||||
STRING | cassava4.1_018110m | 3e-57 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA7240 | 22 | 32 |
Publications ? help Back to Top | |||
---|---|---|---|
|