PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100177760031
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family GRAS
Protein Properties Length: 557aa    MW: 61993.5 Da    PI: 5.2326
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100177760031genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS364.61.3e-1111705571374
                          GRAS   1 lvelLlecAeavssgdle..........laqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetse 71 
                                   l++lL++cAe+vs+ d            +a++l+ +l++++s +gdp+qRl ay++eAL+arl++s+++++k+l+++e s 
  Ote100177760031|100177760031 170 LKQLLIACAEVVSEADIVplserkmaadAAESLMYTLEKTVSVSGDPLQRLGAYMLEALRARLLSSGNSICKKLKCNEPS- 249
                                   5799*********9765333344455668999***********************************************9. PP

                          GRAS  72 knsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspes 152
                                       + ++ ++l+ +++P++kf++  aN  I++a+e+e+r+H+iDf+i qG  W++++qa++ Rp+gpp+lRiTgv+++es
  Ote100177760031|100177760031 250 --GPDLMSHMQLLAQICPFYKFAYTSANVVIMDAMENESRIHVIDFQIAQGSLWMSFIQAISRRPGGPPHLRITGVDDSES 328
                                   ..9999999*********************************************************************998 PP

                          GRAS 153 g..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklv 231
                                   +  +   l+ +g+rLa++Ae++gvpfef+  +a +  d++le+L+v++gEalaVn+ + lh+++desvs +++rd++L+lv
  Ote100177760031|100177760031 329 SyaRGGGLQVIGQRLAQVAESCGVPFEFHD-AAVSECDVQLENLKVRRGEALAVNFPFVLHHIPDESVSPDNHRDRLLRLV 408
                                   899999************************.78888999****************************************** PP

                          GRAS 232 kslsPkv......vvvveqeadhnsesFlerflealeyysalfdsl.eaklpreseerikvErellgreivnvvacegaer 305
                                   ksls             eqe+++n+++F  rf e+l+yy+a+f+++ ++ l+r++  ri+ E++++++++vn++aceg+er
  Ote100177760031|100177760031 409 KSLSXXXxxxxxxXXXXEQESNTNTAPFPVRFRETLDYYTAMFEAIdASALGRDDGRRINAEEHCVAKDVVNIIACEGRER 489
                                   ***98761111115678*****************************88889****************************** PP

                          GRAS 306 rerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                   +erhe ++kWr rl++aGF+pvpl  ++   ++ +lr+++ + y + e +g+l++gWk+r+Lv++SaWr
  Ote100177760031|100177760031 490 EERHELFGKWRLRLTMAGFSPVPLPPTVCPAVRDMLREYSPN-YALAEGNGALFIGWKNRALVTFSAWR 557
                                   ****************************************55.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.514144538IPR005202Transcription factor GRAS
PfamPF035144.7E-109170557IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MHASQEAPSS VQNSHRLPRQ QTVPYSFSGS QISNNDLTHN EMQGKGLSFQ SYADQFYTLE  60
STPLSDYSVY NSPSAVSVSS NRSPFSPQLS HSYMSDHHHS SDNTYGSPLD GSFGGGDEDN  120
WIPTLWMLRN ELLGPDCDIE YSSSVPPGVM QPSYVTSYNR ILEMAPNMDL KQLLIACAEV  180
VSEADIVPLS ERKMAADAAE SLMYTLEKTV SVSGDPLQRL GAYMLEALRA RLLSSGNSIC  240
KKLKCNEPSG PDLMSHMQLL AQICPFYKFA YTSANVVIMD AMENESRIHV IDFQIAQGSL  300
WMSFIQAISR RPGGPPHLRI TGVDDSESSY ARGGGLQVIG QRLAQVAESC GVPFEFHDAA  360
VSECDVQLEN LKVRRGEALA VNFPFVLHHI PDESVSPDNH RDRLLRLVKS LSXXXXXXXX  420
XXXXXEQESN TNTAPFPVRF RETLDYYTAM FEAIDASALG RDDGRRINAE EHCVAKDVVN  480
IIACEGRERE ERHELFGKWR LRLTMAGFSP VPLPPTVCPA VRDMLREYSP NYALAEGNGA  540
LFIGWKNRAL VTFSAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A2e-4717755625377Protein SCARECROW
5b3h_D2e-4717755625377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a positive regulator of continuous red light signals downstream of phytochrome B (phyB). Required for the regulation of hypocotyl elongation during de-etiolation. May be required to modulate phytochrome A (phyA) signal transduction in a phyB-independent way. {ECO:0000269|PubMed:16680434}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By osmotic and cold stresses, and UV-A/B. {ECO:0000269|PubMed:16680434}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012849068.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLA0A291I3050.0A0A291I305_SALMI; GRAS4 transcription factor
STRINGMigut.M01421.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111