PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100169150011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family MYB
Protein Properties Length: 256aa    MW: 29124.8 Da    PI: 10.1121
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100169150011genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.7e-172370148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  rg+WT +Ed  l+++++ +G g+W++ ar  g++Rt+k+c++rw++yl
  Ote100169150011|100169150011 23 RGPWTVDEDFTLINYIAHHGEGRWNSLARSAGLKRTGKSCRLRWLNYL 70
                                  89********************************************97 PP

2Myb_DNA-binding51.81.9e-1676119146
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Ote100169150011|100169150011  76 RGNITLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 119
                                   7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.0691870IPR017930Myb domain
SuperFamilySSF466892.13E-3021117IPR009057Homeodomain-like
SMARTSM007173.5E-142272IPR001005SANT/Myb domain
PfamPF002494.8E-162370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-212477IPR009057Homeodomain-like
CDDcd001674.43E-102570No hitNo description
PROSITE profilePS5129423.24671125IPR017930Myb domain
SMARTSM007171.3E-1475123IPR001005SANT/Myb domain
PfamPF002493.9E-1576119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-2378124IPR009057Homeodomain-like
CDDcd001671.02E-696119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MDRHEEGKAS GNYSEEDLLE LRRGPWTVDE DFTLINYIAH HGEGRWNSLA RSAGLKRTGK  60
SCRLRWLNYL RPDVRRGNIT LEEQLLILEL HSRWGNRWSK IAQHLPGRTD NEIKNYWRTR  120
VQKHAKQLKC DVNSKQFKDT MRYLWMPRLV ERIQASAAAA PNLSAQTAST AAXXXXXXPP  180
PPTLSSPTSP TVTTTTPPIR ITINPQRHLI SIKGWISSNK TALGRWTAEM CPTVCGMLMT  240
CGTCNSNSTA MLEIIY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-252011724120MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269|PubMed:22301384}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269|PubMed:22301384}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022851356.11e-100transcription factor MYB108-like
SwissprotQ10MB49e-90MYB2_ORYSJ; Transcription factor MYB2
TrEMBLA0A059PRD93e-96A0A059PRD9_SALMI; MYB-related transcription factor
STRINGSolyc05g053330.2.12e-95(Solanum lycopersicum)
STRINGXP_009612140.19e-96(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13972375
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Yang A,Dai X,Zhang WH
    A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice.
    J. Exp. Bot., 2012. 63(7): p. 2541-56
    [PMID:22301384]
  3. Chen X, et al.
    The NAC family transcription factor OsNAP confers abiotic stress response through the ABA pathway.
    Plant Cell Physiol., 2014. 55(3): p. 604-19
    [PMID:24399239]
  4. Lv Y, et al.
    New insights into the genetic basis of natural chilling and cold shock tolerance in rice by genome-wide association analysis.
    Plant Cell Environ., 2016. 39(3): p. 556-70
    [PMID:26381647]
  5. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]